BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0196 (774 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 22 4.7 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 6.3 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 8.3 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 8.3 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.3 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.3 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 21 8.3 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 21 8.3 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 22.2 bits (45), Expect = 4.7 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 397 QVLKPWYRKPDRLVCRGRH*RSLCCNQLFQ 308 Q + +YR +RLV RG H +L +Q Sbjct: 558 QTERRFYRHRERLVARGIHAEALVPRWCYQ 587 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.8 bits (44), Expect = 6.3 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 502 ASAPVCGIWIRTP 540 A+ VCG+W R P Sbjct: 224 ATRKVCGVWKRIP 236 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.4 bits (43), Expect = 8.3 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +1 Query: 367 QAYGT--RVLGPGGDSTNYGGRLDW 435 + +GT RV P T YGGRL W Sbjct: 75 KVHGTTVRVRPPKVYPTPYGGRLVW 99 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 8.3 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +1 Query: 367 QAYGT--RVLGPGGDSTNYGGRLDW 435 + +GT RV P T YGGRL W Sbjct: 389 KVHGTTVRVRPPKVYPTPYGGRLVW 413 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 8.3 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +1 Query: 367 QAYGT--RVLGPGGDSTNYGGRLDW 435 + +GT RV P T YGGRL W Sbjct: 622 KVHGTTVRVRPPKVYPTPYGGRLVW 646 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 8.3 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +1 Query: 367 QAYGT--RVLGPGGDSTNYGGRLDW 435 + +GT RV P T YGGRL W Sbjct: 622 KVHGTTVRVRPPKVYPTPYGGRLVW 646 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 325 NKEIFNDDRGKLTGQAYGT 381 + E FN+ R K+ Q +GT Sbjct: 96 SSEAFNEFRTKILAQVHGT 114 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 210 GNPQGDTPVTSLGTNNGGRQG 272 G+P +PV +L + GG G Sbjct: 205 GSPTDHSPVLNLSKSGGGSAG 225 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,096 Number of Sequences: 336 Number of extensions: 4119 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -