BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0196 (774 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF000193-3|AAB52890.1| 259|Caenorhabditis elegans Hypothetical ... 29 4.9 AC006807-4|AAK84618.1| 904|Caenorhabditis elegans Hypothetical ... 29 4.9 AC006807-3|AAK84617.1| 883|Caenorhabditis elegans Hypothetical ... 29 4.9 >AF000193-3|AAB52890.1| 259|Caenorhabditis elegans Hypothetical protein T20B6.3 protein. Length = 259 Score = 28.7 bits (61), Expect = 4.9 Identities = 19/55 (34%), Positives = 23/55 (41%) Frame = +1 Query: 259 GGGKVFGTLGQNDDGLFGKAGYNKEIFNDDRGKLTGQAYGTRVLGPGGDSTNYGG 423 GGG G G DG +G G+ G + G YG +G GG YGG Sbjct: 167 GGGMGGGGYGGGGDGGYGGGGFGGGGMGGYGGGMGGGGYGGGGMGGGG----YGG 217 >AC006807-4|AAK84618.1| 904|Caenorhabditis elegans Hypothetical protein Y58A7A.4 protein. Length = 904 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/58 (27%), Positives = 27/58 (46%) Frame = -1 Query: 696 PILNNKKKLIYLAKDYCLSVEVITNHGGSLLEDRRLVFCDRTPSRPYHRQKSGCSYPD 523 PI N + L + +EVIT G + ED++L+ +T + Y R + + D Sbjct: 425 PIRRNGENLRKIVSSAPTVLEVITKISGDVAEDKQLISRIKTSEKFYGRPSTSVDWND 482 >AC006807-3|AAK84617.1| 883|Caenorhabditis elegans Hypothetical protein Y58A7A.3 protein. Length = 883 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/58 (27%), Positives = 27/58 (46%) Frame = -1 Query: 696 PILNNKKKLIYLAKDYCLSVEVITNHGGSLLEDRRLVFCDRTPSRPYHRQKSGCSYPD 523 PI N + L + +EVIT G + ED++L+ +T + Y R + + D Sbjct: 406 PIRRNGENLRKIVSSAPTVLEVITKISGDVAEDKQLISRIKTSEKFYGRPSTSVDWND 463 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,297,449 Number of Sequences: 27780 Number of extensions: 372110 Number of successful extensions: 944 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 863 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 942 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1861650246 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -