BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0194 (766 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 22 6.2 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 8.2 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 306 GKLDALIQFWVIFGYSCSENKTREFFVLLYLIQFIN 413 G LD+LI V+ KT+E+ L Q+I+ Sbjct: 81 GSLDSLILLMVLVSIILGSLKTKEWAKLNNKFQYID 116 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = +1 Query: 175 AFSIQPHLLYLVWYPHSVTLGEGRSHSRL 261 A ++ +L Y W + T+GEG+ ++ Sbjct: 1269 AKNLDSNLKYEFWVTAATTIGEGQPSKKV 1297 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,764 Number of Sequences: 336 Number of extensions: 4662 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -