BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0194 (766 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0532 + 18386593-18386722,18386826-18386900,18387098-183875... 29 3.1 10_05_0012 + 7874326-7874831,7929715-7931393,7931508-7933396 28 9.4 09_02_0581 + 10890635-10890725,10891051-10891140,10892585-108928... 28 9.4 02_05_0977 - 33239887-33240566,33241010-33241985 28 9.4 02_05_0948 - 33003921-33006269 28 9.4 02_02_0537 + 11308195-11309667 28 9.4 01_05_0645 - 23899579-23904483 28 9.4 >09_04_0532 + 18386593-18386722,18386826-18386900,18387098-18387510, 18387682-18387688,18387944-18388005,18388046-18388341, 18388456-18388813,18388916-18389491,18389956-18390231 Length = 730 Score = 29.5 bits (63), Expect = 3.1 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +2 Query: 197 CSTSYGTHT--LSHWARAALTRASGFYIYIRSRADKTMWKVGCSDSVLGNFW 346 C +YG + LS W R +T ++ + R ++ +WK+G + L FW Sbjct: 610 CGWAYGMNVFDLSEWRRQKITDV--YHNWQRLNENRILWKLGTLPAGLVTFW 659 >10_05_0012 + 7874326-7874831,7929715-7931393,7931508-7933396 Length = 1357 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 591 ILHRHPNGLPTLQ*RLTQPVLNCLFCCYRNT 683 ILH HPN TQP C C Y+++ Sbjct: 1015 ILHNHPNSFLPQYILRTQPKAPCRSCAYKDS 1045 >09_02_0581 + 10890635-10890725,10891051-10891140,10892585-10892857, 10893037-10893054,10893458-10893526,10893991-10894042, 10894706-10895093 Length = 326 Score = 27.9 bits (59), Expect = 9.4 Identities = 19/55 (34%), Positives = 28/55 (50%) Frame = +2 Query: 137 QLMTSSEVSAGWSHSASSLICSTSYGTHTLSHWARAALTRASGFYIYIRSRADKT 301 +L S EVS+ W ++L+C+T GT + A AL + S +RAD T Sbjct: 249 RLRGSYEVSSMWKVVDTALLCTTDIGTQRPTMAAVVALLKES--LALEETRADST 301 >02_05_0977 - 33239887-33240566,33241010-33241985 Length = 551 Score = 27.9 bits (59), Expect = 9.4 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = +2 Query: 83 SPALREEQPFRLWVLKHGQLMTSSEVSAGWSHSASSLICSTSYGTHTLSHWARAALT 253 SPA F WV KH + + SS S + + +++ GTHT A AA+T Sbjct: 198 SPAPPSRAAFPSWVTKHDRHLLSSPAS---TIAPDAVVALDGSGTHTSISDAIAAVT 251 >02_05_0948 - 33003921-33006269 Length = 782 Score = 27.9 bits (59), Expect = 9.4 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 11/63 (17%) Frame = +2 Query: 173 SHSASSLICSTSYGTHTLSHWARAALTRASGFYIYIRSRAD-----------KTMWKVGC 319 + + S + + +GTHT S A + +T A GF+ Y R +A K WK GC Sbjct: 213 TEESKSPLDTEGHGTHTASTAAGSPVTGA-GFFDYARGQAVGMSPAAHIAAYKICWKSGC 271 Query: 320 SDS 328 DS Sbjct: 272 YDS 274 >02_02_0537 + 11308195-11309667 Length = 490 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 591 ILHRHPNGLPTLQ*RLTQPVLNCLFCCYRNT 683 ILH HPN TQP C C Y+++ Sbjct: 173 ILHNHPNSFLPQYILRTQPKAPCRSCAYKDS 203 >01_05_0645 - 23899579-23904483 Length = 1634 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 591 ILHRHPNGLPTLQ*RLTQPVLNCLFCCYRNT 683 ILH HPN TQP C C Y+++ Sbjct: 1292 ILHNHPNSFLPQYILRTQPKAPCRSCAYKDS 1322 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,346,830 Number of Sequences: 37544 Number of extensions: 449397 Number of successful extensions: 1122 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1092 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1122 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2051430072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -