BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0193 (590 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 29 0.15 AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 26 1.0 AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 24 3.2 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 24 3.2 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 24 3.2 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 24 3.2 AJ970243-1|CAI96715.1| 129|Anopheles gambiae putative reverse t... 24 4.2 AY341201-1|AAR13765.1| 154|Anopheles gambiae NOS protein. 23 5.6 AY341200-1|AAR13764.1| 154|Anopheles gambiae NOS protein. 23 5.6 AY341199-1|AAR13763.1| 154|Anopheles gambiae NOS protein. 23 5.6 AY341198-1|AAR13762.1| 154|Anopheles gambiae NOS protein. 23 5.6 AY341197-1|AAR13761.1| 154|Anopheles gambiae NOS protein. 23 5.6 AY341196-1|AAR13760.1| 154|Anopheles gambiae NOS protein. 23 5.6 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 23 7.4 AY330172-1|AAQ16278.1| 170|Anopheles gambiae odorant-binding pr... 23 9.8 AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding pr... 23 9.8 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 28.7 bits (61), Expect = 0.15 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = +3 Query: 363 KPFKQTS--GKVVGAYFVEWGVYPR---KFPVDRVPVPNLTHLLYGFIPI 497 +P K S GK V Y W VY ++ ++ + THL+YGF I Sbjct: 21 EPHKAASAEGKKVVCYVGTWAVYRPGNGRYDIEHIDPSLCTHLMYGFFGI 70 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 25.8 bits (54), Expect = 1.0 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 395 HHFSRSLLEGLIFLTNRIIE 336 HHF R+ LE + F T IIE Sbjct: 389 HHFVRAALEAVCFQTRDIIE 408 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 429 RKFPVDRVPVPNLTHLLYGFIPI 497 RK V+ VP P L + GF P+ Sbjct: 147 RKLAVNMVPFPRLHFFMPGFAPL 169 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 429 RKFPVDRVPVPNLTHLLYGFIPI 497 RK V+ VP P L + GF P+ Sbjct: 147 RKLAVNMVPFPRLHFFMPGFAPL 169 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 429 RKFPVDRVPVPNLTHLLYGFIPI 497 RK V+ VP P L + GF P+ Sbjct: 147 RKLAVNMVPFPRLHFFMPGFAPL 169 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 429 RKFPVDRVPVPNLTHLLYGFIPI 497 RK V+ VP P L + GF P+ Sbjct: 147 RKLAVNMVPFPRLHFFMPGFAPL 169 >AJ970243-1|CAI96715.1| 129|Anopheles gambiae putative reverse transcriptase protein. Length = 129 Score = 23.8 bits (49), Expect = 4.2 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -1 Query: 578 HGRCMNVVVLENCPQFLSNCH*CLTTTNRNEAV 480 HG V N +F+SNCH T+ + +AV Sbjct: 36 HGFFPRRSVTTNLVKFVSNCHAAFTSGAQMDAV 68 >AY341201-1|AAR13765.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.4 bits (48), Expect = 5.6 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +3 Query: 360 NKPFKQTSGKVVGAYFVEWGVYPRKFPVDRVPVPNLTHLLYGFIPI 497 N P ++ +V+ + GVY P +R+PV +L LL F+ I Sbjct: 15 NDPDEELQLQVLKEKQTQNGVYKSWEPHERLPVCSLRTLLTRFMDI 60 >AY341200-1|AAR13764.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.4 bits (48), Expect = 5.6 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +3 Query: 360 NKPFKQTSGKVVGAYFVEWGVYPRKFPVDRVPVPNLTHLLYGFIPI 497 N P ++ +V+ + GVY P +R+PV +L LL F+ I Sbjct: 15 NDPDEELQLQVLKEKQTQNGVYKSWEPHERLPVCSLRTLLTRFMDI 60 >AY341199-1|AAR13763.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.4 bits (48), Expect = 5.6 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +3 Query: 360 NKPFKQTSGKVVGAYFVEWGVYPRKFPVDRVPVPNLTHLLYGFIPI 497 N P ++ +V+ + GVY P +R+PV +L LL F+ I Sbjct: 15 NDPDEELQLQVLKEKQTQNGVYKSWEPHERLPVCSLRTLLTRFMDI 60 >AY341198-1|AAR13762.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.4 bits (48), Expect = 5.6 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +3 Query: 360 NKPFKQTSGKVVGAYFVEWGVYPRKFPVDRVPVPNLTHLLYGFIPI 497 N P ++ +V+ + GVY P +R+PV +L LL F+ I Sbjct: 15 NDPDEELQLQVLKEKQTQNGVYKSWEPHERLPVCSLRTLLTRFMDI 60 >AY341197-1|AAR13761.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.4 bits (48), Expect = 5.6 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +3 Query: 360 NKPFKQTSGKVVGAYFVEWGVYPRKFPVDRVPVPNLTHLLYGFIPI 497 N P ++ +V+ + GVY P +R+PV +L LL F+ I Sbjct: 15 NDPDEELQLQVLKEKQTQNGVYKSWEPHERLPVCSLRTLLTRFMDI 60 >AY341196-1|AAR13760.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.4 bits (48), Expect = 5.6 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +3 Query: 360 NKPFKQTSGKVVGAYFVEWGVYPRKFPVDRVPVPNLTHLLYGFIPI 497 N P ++ +V+ + GVY P +R+PV +L LL F+ I Sbjct: 15 NDPDEELQLQVLKEKQTQNGVYKSWEPHERLPVCSLRTLLTRFMDI 60 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 23.0 bits (47), Expect = 7.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 Query: 319 PSVSATTISTPSLELH 272 PSV T +TPSL LH Sbjct: 171 PSVIDVTFATPSLVLH 186 >AY330172-1|AAQ16278.1| 170|Anopheles gambiae odorant-binding protein AgamOBP52 protein. Length = 170 Score = 22.6 bits (46), Expect = 9.8 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 572 RCMNVVVLENCP 537 RC+ +++ ENCP Sbjct: 139 RCVRLLIYENCP 150 >AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding protein OBPjj5a protein. Length = 272 Score = 22.6 bits (46), Expect = 9.8 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 572 RCMNVVVLENCP 537 RC+ +++ ENCP Sbjct: 241 RCVRLLIYENCP 252 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 588,526 Number of Sequences: 2352 Number of extensions: 11259 Number of successful extensions: 40 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56768445 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -