BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0185 (675 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1556 - 38222071-38222708,38222795-38222822,38222950-382230... 29 4.5 02_03_0407 - 18675368-18675378,18676047-18676977,18677323-186773... 28 5.9 >01_06_1556 - 38222071-38222708,38222795-38222822,38222950-38223070, 38223206-38223318,38223424-38223506,38223868-38223930, 38224100-38224254,38224411-38224580,38225101-38225189, 38225304-38225496,38225655-38225779,38226069-38226475, 38226855-38226919,38227414-38227692,38227772-38227845, 38228241-38228292,38228366-38228473,38228871-38228972, 38229100-38229173,38229262-38229435,38229667-38229771, 38229867-38229977,38230364-38230487 Length = 1150 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 261 DYIVKWQNLIFCKCGCYFHGCCKDGVSVA 347 +++VKW+ L +C+ + CC DGV A Sbjct: 473 EFLVKWKGLDYCE--ATWEPCCTDGVQQA 499 >02_03_0407 - 18675368-18675378,18676047-18676977,18677323-18677376, 18677809-18678039,18678112-18678319,18678405-18678433, 18678638-18678706,18678832-18678893,18679056-18679133, 18679243-18679315,18681135-18681260 Length = 623 Score = 28.3 bits (60), Expect = 5.9 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 5/90 (5%) Frame = +1 Query: 76 SYCRSDRKCSNNLKPKVKLISKKN--KFWFI*L---FQNNLGLSTYLNIIPASEASIK** 240 S+ R KC L+P+VK IS+K+ + F L +N G STY + E S Sbjct: 217 SFFRKGLKCLEALEPRVKAISEKHHIDYNFSGLEDDGSDNDGYSTYDSCSDDGELSFDYE 276 Query: 241 CNERDRLIIL*NGRILYFVNVAATSMVAVK 330 N+RD+ + G + + + TS +K Sbjct: 277 INDRDQDFLTSRGSMDFDKSDQTTSPKPIK 306 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,827,016 Number of Sequences: 37544 Number of extensions: 251856 Number of successful extensions: 484 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 484 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1714968940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -