BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0185 (675 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119656-1|AAM50310.1| 460|Drosophila melanogaster SD02418p pro... 31 1.9 AE014296-1211|AAF50597.1| 460|Drosophila melanogaster CG8616-PA... 31 1.9 >AY119656-1|AAM50310.1| 460|Drosophila melanogaster SD02418p protein. Length = 460 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/32 (53%), Positives = 20/32 (62%), Gaps = 3/32 (9%) Frame = -2 Query: 362 CNLSMG-NTNAIFTATMEVAATF--TKYKILP 276 CN SMG N NAI++ E ATF TK +LP Sbjct: 46 CNYSMGKNNNAIYSRDTESGATFVSTKVAVLP 77 >AE014296-1211|AAF50597.1| 460|Drosophila melanogaster CG8616-PA protein. Length = 460 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/32 (53%), Positives = 20/32 (62%), Gaps = 3/32 (9%) Frame = -2 Query: 362 CNLSMG-NTNAIFTATMEVAATF--TKYKILP 276 CN SMG N NAI++ E ATF TK +LP Sbjct: 46 CNYSMGKNNNAIYSRDTESGATFVSTKVAVLP 77 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,852,235 Number of Sequences: 53049 Number of extensions: 463119 Number of successful extensions: 954 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 886 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 954 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2930645700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -