BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0183 (716 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41995-2|AAA83460.1| 317|Caenorhabditis elegans Serpentine rece... 30 1.4 Z68751-4|CAA92974.1| 425|Caenorhabditis elegans Hypothetical pr... 28 7.7 >U41995-2|AAA83460.1| 317|Caenorhabditis elegans Serpentine receptor, class x protein46 protein. Length = 317 Score = 30.3 bits (65), Expect = 1.4 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 5/58 (8%) Frame = +3 Query: 3 CLFSWKNRTIM--YSVNAI*I---FYFIL*KMQIILAVVIFCNIFVILENRIVYRKRK 161 C +SW M Y V+ + FY I K I+ +++ ++FVI + R +Y+K K Sbjct: 143 CKYSWSTEMWMFLYHVSNQCVSFSFYAIFCKYISIIFIIVLIDVFVICKARFMYKKSK 200 >Z68751-4|CAA92974.1| 425|Caenorhabditis elegans Hypothetical protein T05E11.4 protein. Length = 425 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 546 KVVYGRQSYVITSVAELLELLN 611 K VYG Q Y+ +S+ + ELLN Sbjct: 122 KAVYGNQKYLDSSIKSICELLN 143 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,110,137 Number of Sequences: 27780 Number of extensions: 257061 Number of successful extensions: 541 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 541 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1676746902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -