BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0183 (716 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g18910.1 68414.m02354 zinc finger (C3HC4-type RING finger) fa... 28 7.1 At1g33250.1 68414.m04110 fringe-related protein + weak similarit... 27 9.4 >At1g18910.1 68414.m02354 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain PF00097: Zinc finger, C3HC4 type (RING finger) Length = 195 Score = 27.9 bits (59), Expect = 7.1 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +3 Query: 636 KCVTIQRLGVSCVSIACSA 692 KC+ IQ +G SC +I+CS+ Sbjct: 5 KCMIIQPVGASCSNISCSS 23 >At1g33250.1 68414.m04110 fringe-related protein + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 548 Score = 27.5 bits (58), Expect = 9.4 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +3 Query: 81 MQIILAVVIFCNIFVILENRIVYRKRKANISRPPPSVD*CNL 206 M++IL V+ C+ L + +R + ISRPPP + C L Sbjct: 1 MRLILTVM--CSFIPYLYSSSPHRPCSSPISRPPPRIRPCRL 40 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,017,644 Number of Sequences: 28952 Number of extensions: 227320 Number of successful extensions: 414 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1555552968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -