BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0182 (703 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 28 0.33 EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. 23 9.3 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 27.9 bits (59), Expect = 0.33 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -3 Query: 599 INSNSSFL-TFLQTFRQTNDFLKRRNREGAILRALPALISGMRSL 468 I SN SF+ T+L Q L R++ + A + AL A +S +RSL Sbjct: 416 ITSNISFMATYLVVLMQFKLTLLRQSAKNAFISALKANLSRIRSL 460 >EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. Length = 481 Score = 23.0 bits (47), Expect = 9.3 Identities = 8/17 (47%), Positives = 14/17 (82%) Frame = -1 Query: 691 GHGIRFMEYVHNSSSIA 641 GHG+R++E + SSS++ Sbjct: 311 GHGMRWVELPYESSSLS 327 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 766,836 Number of Sequences: 2352 Number of extensions: 15359 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -