BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0182 (703 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g08030.1 68418.m00934 glycerophosphoryl diester phosphodieste... 89 3e-18 At1g74210.1 68414.m08595 glycerophosphoryl diester phosphodieste... 81 7e-16 At1g66970.1 68414.m07615 glycerophosphoryl diester phosphodieste... 38 0.005 At4g26690.1 68417.m03846 glycerophosphoryl diester phosphodieste... 37 0.011 At5g58050.1 68418.m07265 glycerophosphoryl diester phosphodieste... 36 0.026 At1g66980.1 68414.m07616 protein kinase family protein / glycero... 34 0.10 At5g58170.1 68418.m07281 glycerophosphoryl diester phosphodieste... 33 0.14 At5g55480.1 68418.m06910 glycerophosphoryl diester phosphodieste... 32 0.42 At2g03630.1 68415.m00323 hypothetical protein 30 1.3 At5g25040.1 68418.m02967 integral membrane transporter family pr... 28 5.2 At1g08000.2 68414.m00873 zinc finger (GATA type) family protein ... 28 5.2 At1g08000.1 68414.m00872 zinc finger (GATA type) family protein ... 28 5.2 At3g01460.1 68416.m00070 PHD finger family protein / methyl-CpG ... 28 6.9 At2g31290.1 68415.m03820 expressed protein 28 6.9 At1g20410.1 68414.m02545 expressed protein 28 6.9 At1g08010.1 68414.m00874 zinc finger (GATA type) family protein ... 27 9.1 >At5g08030.1 68418.m00934 glycerophosphoryl diester phosphodiesterase family protein similar to glycerophosphodiester phosphodiesterase [Borrelia hermsii] GI:1399038; contains Pfam profile PF03009: Glycerophosphoryl diester phosphodiesterase family Length = 372 Score = 88.6 bits (210), Expect = 3e-18 Identities = 42/74 (56%), Positives = 52/74 (70%) Frame = +1 Query: 262 GADYIEPDLVMTKDGVLVARHDNELSLTTDVASRIEFATRNRTQTVDGSAITGWFTEDFT 441 GAD+IE D++ +KDGVL+ HD L TTDVA EFA R RT V G +TG+FT DFT Sbjct: 71 GADFIETDILSSKDGVLICHHDVNLDDTTDVADHKEFADRKRTYEVQGMNMTGFFTVDFT 130 Query: 442 LAEIKTLRARERIP 483 L E+KTL A++R P Sbjct: 131 LKELKTLGAKQRYP 144 Score = 31.9 bits (69), Expect = 0.42 Identities = 19/44 (43%), Positives = 24/44 (54%) Frame = +3 Query: 483 RYQSWQRT*DGTFTIPTFQEIISLAKGLQKSQKRTIGIYPEIKH 614 RY + +G F I TF E IS+A R +GIYPEIK+ Sbjct: 142 RYPFRDQQYNGKFPIITFDEYISIAL----DAPRVVGIYPEIKN 181 >At1g74210.1 68414.m08595 glycerophosphoryl diester phosphodiesterase family protein low similarity to glycerophosphodiester phosphodiesterase [Borrelia hermsii] GI:1399038; contains Pfam profile PF03009: Glycerophosphoryl diester phosphodiesterase family Length = 392 Score = 81.0 bits (191), Expect = 7e-16 Identities = 40/72 (55%), Positives = 50/72 (69%) Frame = +1 Query: 262 GADYIEPDLVMTKDGVLVARHDNELSLTTDVASRIEFATRNRTQTVDGSAITGWFTEDFT 441 G D+IE D++ +KDGVL+ HD L TT+VAS EFA R RT V G ITG+FT DFT Sbjct: 71 GTDFIETDILSSKDGVLICFHDCILDETTNVASHKEFADRKRTYDVQGFNITGFFTFDFT 130 Query: 442 LAEIKTLRARER 477 L E+K LR ++R Sbjct: 131 LKELKQLRIKQR 142 Score = 32.7 bits (71), Expect = 0.24 Identities = 18/54 (33%), Positives = 29/54 (53%) Frame = +3 Query: 453 KNVTS*RTHTRYQSWQRT*DGTFTIPTFQEIISLAKGLQKSQKRTIGIYPEIKH 614 K + R RY + +G + I TF+E +++A+ R +GIYPEIK+ Sbjct: 132 KELKQLRIKQRYAFRDQQYNGMYPIITFEEFLTIAR----DAPRVVGIYPEIKN 181 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/37 (35%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +2 Query: 182 PLIIAHRGASGYVPEHTLGSY--ALSKPWELITSNLI 286 P IAHRG++G +PE T +Y A+ + + I ++++ Sbjct: 44 PYNIAHRGSNGEIPEETTAAYLKAIEEGTDFIETDIL 80 >At1g66970.1 68414.m07615 glycerophosphoryl diester phosphodiesterase family protein contains Pfam PF03009 : Glycerophosphoryl diester phosphodiesterase family Length = 763 Score = 38.3 bits (85), Expect = 0.005 Identities = 19/58 (32%), Positives = 34/58 (58%) Frame = +1 Query: 283 DLVMTKDGVLVARHDNELSLTTDVASRIEFATRNRTQTVDGSAITGWFTEDFTLAEIK 456 DL +TKDG+ + D L+ + + R+ + R ++ +V+G GWF DF+L E++ Sbjct: 86 DLQLTKDGLGICFPDLNLANASTI-DRV-YPNREKSYSVNGVTTKGWFPNDFSLTELQ 141 >At4g26690.1 68417.m03846 glycerophosphoryl diester phosphodiesterase family protein weak similarity to glycerophosphodiester phosphodiesterase [Borrelia hermsii] GI:1399038; contains Pfam profile PF03009: Glycerophosphoryl diester phosphodiesterase family Length = 759 Score = 37.1 bits (82), Expect = 0.011 Identities = 18/58 (31%), Positives = 33/58 (56%) Frame = +1 Query: 283 DLVMTKDGVLVARHDNELSLTTDVASRIEFATRNRTQTVDGSAITGWFTEDFTLAEIK 456 D+ +TKD + + D L++ + + TR ++ V+G +GWFT DF+L ++K Sbjct: 80 DVQLTKDALGICFPD--LTMRNSSSIEAVYPTRQKSYPVNGVPTSGWFTIDFSLKDLK 135 >At5g58050.1 68418.m07265 glycerophosphoryl diester phosphodiesterase family protein contains Pfam PF03009 : Glycerophosphoryl diester phosphodiesterase family; similar to Glycerophosphoryl diester phosphodiesterase precursor (Glycerophosphodiester phosphodiesterase) (Surface-exposed lipoprotein D) (Protein D) (ImmunoglobulinD-binding protein) (IGD-binding protein) (SP:Q06282) {Haemophilus influenzae} Length = 753 Score = 35.9 bits (79), Expect = 0.026 Identities = 26/85 (30%), Positives = 41/85 (48%) Frame = +1 Query: 262 GADYIEPDLVMTKDGVLVARHDNELSLTTDVASRIEFATRNRTQTVDGSAITGWFTEDFT 441 GAD I+ + M+KDG+ +LS +T +R F +R T + G F+ D T Sbjct: 382 GADIIDCSVQMSKDGIAFCHDAADLSAST--TARTTFMSR-ATSVPEIQPTNGIFSFDLT 438 Query: 442 LAEIKTLRARERIPDIRAGNARRMA 516 AEI++++ + P G R A Sbjct: 439 WAEIQSVKPQIENPFTATGFQRNPA 463 Score = 34.7 bits (76), Expect = 0.060 Identities = 19/52 (36%), Positives = 27/52 (51%) Frame = +1 Query: 283 DLVMTKDGVLVARHDNELSLTTDVASRIEFATRNRTQTVDGSAITGWFTEDF 438 +L MTKDGV + D L T ++S F +T V+G + GWF D+ Sbjct: 77 NLQMTKDGVGLCLSDIRLDNATTISS--VFPKAQKTYKVNGQDLKGWFVIDY 126 >At1g66980.1 68414.m07616 protein kinase family protein / glycerophosphoryl diester phosphodiesterase family protein similar to leaf rust resistance kinase Lr10 GI:1680685 from [Triticum aestivum]; contains Pfam profiles PF03009: Glycerophosphoryl diester phosphodiesterase family, PF00069: Protein kinase domain Length = 1109 Score = 33.9 bits (74), Expect = 0.10 Identities = 19/58 (32%), Positives = 30/58 (51%) Frame = +1 Query: 283 DLVMTKDGVLVARHDNELSLTTDVASRIEFATRNRTQTVDGSAITGWFTEDFTLAEIK 456 D+ +TKDG + D L+L S + R ++ V+G GWF DF+L E++ Sbjct: 87 DVQLTKDGHGICFPD--LNLANASNSEEVYPNRQKSYPVNGVTTKGWFPIDFSLTELQ 142 >At5g58170.1 68418.m07281 glycerophosphoryl diester phosphodiesterase family protein contains Pfam PF03009 : Glycerophosphoryl diester phosphodiesterase family; similar to Glycerophosphoryl diester phosphodiesterase precursor (Glycerophosphodiester phosphodiesterase) (Surface-exposed lipoprotein D) (Protein D) (ImmunoglobulinD-binding protein) (IGD-binding protein) (SP:Q06282) {Haemophilus influenzae} Length = 750 Score = 33.5 bits (73), Expect = 0.14 Identities = 19/52 (36%), Positives = 27/52 (51%) Frame = +1 Query: 283 DLVMTKDGVLVARHDNELSLTTDVASRIEFATRNRTQTVDGSAITGWFTEDF 438 +L MTKDGV + D L T ++S F +T V+G + GWF D+ Sbjct: 77 NLQMTKDGVGLCLSDIILDNATTISS--VFPKAQKTYKVNGQDLKGWFVLDY 126 Score = 33.5 bits (73), Expect = 0.14 Identities = 26/85 (30%), Positives = 39/85 (45%) Frame = +1 Query: 262 GADYIEPDLVMTKDGVLVARHDNELSLTTDVASRIEFATRNRTQTVDGSAITGWFTEDFT 441 GAD I+ + M+KDG+ HD LT + F +R T + G F+ D T Sbjct: 382 GADVIDCSVQMSKDGIAFC-HD-AADLTASTTAMTIFMSR-ATSVPEIQPTNGIFSFDLT 438 Query: 442 LAEIKTLRARERIPDIRAGNARRMA 516 AEI++++ + P G R A Sbjct: 439 WAEIQSVKPQIENPFTATGFQRNPA 463 >At5g55480.1 68418.m06910 glycerophosphoryl diester phosphodiesterase family protein contains Pfam PF03009 : Glycerophosphoryl diester phosphodiesterase family; similar to Glycerophosphoryl diester phosphodiesterase precursor (Glycerophosphodiester phosphodiesterase) (Surface-exposed lipoprotein D) (Protein D) (ImmunoglobulinD-binding protein) (IGD-binding protein) (SP:Q06282) {Haemophilus influenzae} Length = 766 Score = 31.9 bits (69), Expect = 0.42 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 1/69 (1%) Frame = +1 Query: 262 GADYIEPDLVMTKDGVLVARHDNELSLTTDVASRIEFATRNRTQTV-DGSAITGWFTEDF 438 GAD I+ L M+ DG+ L +T+V ++ RNR+ TV + ++ G ++ Sbjct: 392 GADVIDCSLQMSSDGIPFCLSSINLGESTNV---VQSPFRNRSTTVPEIGSLPGIYSFSL 448 Query: 439 TLAEIKTLR 465 +EI+TLR Sbjct: 449 AWSEIQTLR 457 >At2g03630.1 68415.m00323 hypothetical protein Length = 252 Score = 30.3 bits (65), Expect = 1.3 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Frame = -2 Query: 192 MISGEQKSEFKNSELKSRFS--FTGIPKVIPT-VLKESTNSPKIFILLTQISVREHTKKY 22 +I+ E S +S S S + PK +P VLKES N P+I Q+ R++ KY Sbjct: 46 IINSESHSRLSSSSSSSSSSSSYLSPPKDLPEEVLKESLNDPEISSPPVQVMDRDNNGKY 105 >At5g25040.1 68418.m02967 integral membrane transporter family protein similar to biopterin transporter (GI:3377706) [Leishmania mexicana]; contains Pfam PF03092: BT1 family; contains TIGRFAMS TIGR00788: folate/biopterin transporter; Interpro IPR001991/ PR00173 Sodium:dicarboxylater symporter family Length = 492 Score = 28.3 bits (60), Expect = 5.2 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 3/51 (5%) Frame = +2 Query: 26 FFVCSLTDIWVSNMKIFGLLVLSF---STVGITFGIPVNENLDFNSEFLNS 169 FF+ + V + +FGLL +F S VG+ F P F F N+ Sbjct: 196 FFMSGILVHLVGSKGVFGLLTFTFALVSVVGVLFSEPRVHGFSFKQNFTNA 246 >At1g08000.2 68414.m00873 zinc finger (GATA type) family protein similar to PIR:T05288 from [Arabidopsis thaliana] Length = 308 Score = 28.3 bits (60), Expect = 5.2 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = -3 Query: 146 NQGSHLLEFQK*SPRC*RKAPTARRFSYC*PKYP*ENTQKNTVTK 12 N GS L F R R+ PT R SY P P ++T +VT+ Sbjct: 138 NSGSQRLAFPVKGMRSKRRRPTTVRLSYLFPFEPRKSTPGESVTE 182 >At1g08000.1 68414.m00872 zinc finger (GATA type) family protein similar to PIR:T05288 from [Arabidopsis thaliana] Length = 308 Score = 28.3 bits (60), Expect = 5.2 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = -3 Query: 146 NQGSHLLEFQK*SPRC*RKAPTARRFSYC*PKYP*ENTQKNTVTK 12 N GS L F R R+ PT R SY P P ++T +VT+ Sbjct: 138 NSGSQRLAFPVKGMRSKRRRPTTVRLSYLFPFEPRKSTPGESVTE 182 >At3g01460.1 68416.m00070 PHD finger family protein / methyl-CpG binding domain-containing protein contains Pfam profiles PF00628: PHD-finger (2 copies), PF01429: Methyl-CpG binding domain Length = 2176 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -2 Query: 171 SEFKNSELKSRFSFTGIPKVIPTVLKE 91 SE+KN++++ F + KV P++LKE Sbjct: 1431 SEWKNAKMRQEFLTAKLAKVEPSILKE 1457 >At2g31290.1 68415.m03820 expressed protein Length = 415 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/39 (30%), Positives = 25/39 (64%) Frame = +3 Query: 525 IPTFQEIISLAKGLQKSQKRTIGIYPEIKHSTHFKKLGL 641 I +++ L +G ++S+KR++G+ E+ T +KKL + Sbjct: 237 ISPYEDHGDLVEGSKESEKRSVGLVHELLSLTLWKKLSI 275 >At1g20410.1 68414.m02545 expressed protein Length = 504 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +2 Query: 413 SPVGSRKILHWPK*KRYELENAYQISELATHVGWHLHD 526 SP+ KI+HW K ++ + + Y + L T G ++ + Sbjct: 431 SPLDREKIIHWMKVEKIKGHSHYFLLHLCTQAGTYIKE 468 >At1g08010.1 68414.m00874 zinc finger (GATA type) family protein similar to PIR:T05288 from [Arabidopsis thaliana] Length = 303 Score = 27.5 bits (58), Expect = 9.1 Identities = 18/45 (40%), Positives = 20/45 (44%) Frame = -3 Query: 146 NQGSHLLEFQK*SPRC*RKAPTARRFSYC*PKYP*ENTQKNTVTK 12 N GS L F R RK PT R SY P P +K+T K Sbjct: 137 NNGSQRLAFPVKGMRSKRKRPTTLRLSYLFPSEP-RKPEKSTPGK 180 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,978,260 Number of Sequences: 28952 Number of extensions: 337310 Number of successful extensions: 891 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 875 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 891 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -