BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0180 (592 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0785 + 6095041-6095135,6095455-6095760,6098458-6098554,609... 30 1.2 02_02_0572 + 11667455-11670783,11672026-11672419 30 1.2 04_03_0658 + 18447986-18448117,18448204-18448317,18448388-184485... 29 2.1 05_07_0201 + 28377250-28377515,28377588-28377852,28377927-28378559 28 4.8 01_04_0054 - 15456668-15459691 27 8.5 >07_01_0785 + 6095041-6095135,6095455-6095760,6098458-6098554, 6098943-6098999,6099202-6099751,6099922-6100234, 6100245-6100335,6101002-6101469 Length = 658 Score = 30.3 bits (65), Expect = 1.2 Identities = 22/97 (22%), Positives = 42/97 (43%), Gaps = 3/97 (3%) Frame = +2 Query: 260 DTDNCSTWLNNSSSFVHNLDLYGSEANAVMVNPNSVMPSNFAETPVKSVVKEEASNVLLS 439 DT+N T N+ + D +N PN+ + S + + VV++ SN +L Sbjct: 268 DTNNTDTERNSGQLQLQMQDQLNMVSNDHQTIPNNAVSSELMQCEMSEVVRDGCSNNILE 327 Query: 440 SVANRDSESKHNS---TLASPKEEKST*HFLQTQLKS 541 + ++++ L P E + HFL +L++ Sbjct: 328 DEIQMLMDCQNSNCQLNLQGPDEPCHSWHFLCEELQN 364 >02_02_0572 + 11667455-11670783,11672026-11672419 Length = 1240 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/64 (23%), Positives = 31/64 (48%) Frame = +3 Query: 108 CSDMDLYITDSLQDMLDIDIKNEIATDLSSISDFQDSFGTNFSDMPPLLTWTLIIALRG* 287 CS+++ +I + D + + E+ D +S++DF N +D+P TL+ + Sbjct: 28 CSELETHI--GVGDKVLAEFITELGRDSASVADFDTKLKANGADLPDYFVRTLLTIIHAI 85 Query: 288 ITVP 299 + P Sbjct: 86 LPPP 89 >04_03_0658 + 18447986-18448117,18448204-18448317,18448388-18448507, 18448589-18449215,18449289-18449462,18449545-18449809, 18449889-18449959,18450043-18450145,18450221-18450280, 18450533-18450744,18450830-18450901,18451446-18451502, 18451598-18451882,18452359-18452371,18452396-18452463, 18452649-18452747,18452836-18452967,18453038-18453141, 18453234-18453423,18453519-18453524 Length = 967 Score = 29.5 bits (63), Expect = 2.1 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Frame = +2 Query: 311 NLDLYGSEANAVMV-NPNSVMPSNFAETPVKSVVKEEASNVLLSSVANRDSESKHNSTLA 487 ++D+ +E V N V+P +F+ TP K +K+ S LS + E N + Sbjct: 590 DIDILNNEVTPVFNHNEKYVVPDSFSPTPAKQAIKKLISTKNLSQTLEDNIEDCVNCSDN 649 Query: 488 SPKEEKST 511 KE T Sbjct: 650 EDKENVDT 657 >05_07_0201 + 28377250-28377515,28377588-28377852,28377927-28378559 Length = 387 Score = 28.3 bits (60), Expect = 4.8 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 5/42 (11%) Frame = +2 Query: 377 NFAETPVKSVVKEEASNVL-----LSSVANRDSESKHNSTLA 487 +F P K +++++AS+ + LS +RDSES HN A Sbjct: 133 DFVMVPPKGLLRDKASDAMVHRGWLSMYTSRDSESSHNKDSA 174 >01_04_0054 - 15456668-15459691 Length = 1007 Score = 27.5 bits (58), Expect = 8.5 Identities = 26/78 (33%), Positives = 37/78 (47%), Gaps = 9/78 (11%) Frame = +2 Query: 269 NCSTWLNNSSSFV-HNLDLYGSEAN--AVMVNPNSVMPSNFAETPVKS------VVKEEA 421 NC T S+ + H L + + AVM+N V PS F+ + KS V K+E Sbjct: 233 NCKTKYQYYSNVLNHKLRCQNCKKDFRAVMLNEQDV-PSVFSSSAAKSAGQHCDVPKQED 291 Query: 422 SNVLLSSVANRDSESKHN 475 + SS ANRD++ N Sbjct: 292 CSTKFSSAANRDAKPMVN 309 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,228,107 Number of Sequences: 37544 Number of extensions: 272133 Number of successful extensions: 604 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 588 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 604 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1400060088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -