BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0179 (611 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U66871-1|AAC51172.1| 104|Homo sapiens enhancer of rudimentary h... 96 1e-19 D85758-1|BAA12865.1| 104|Homo sapiens human protein homologous ... 96 1e-19 CR542178-1|CAG46975.1| 104|Homo sapiens ERH protein. 96 1e-19 CR450298-1|CAG29294.1| 104|Homo sapiens ERH protein. 96 1e-19 BT006877-1|AAP35523.1| 104|Homo sapiens enhancer of rudimentary... 96 1e-19 BC071709-1|AAH71709.1| 104|Homo sapiens enhancer of rudimentary... 96 1e-19 BC014301-1|AAH14301.1| 104|Homo sapiens enhancer of rudimentary... 96 1e-19 BC014847-1|AAH14847.1| 436|Homo sapiens origin recognition comp... 29 9.8 AY600302-1|AAS94326.1| 436|Homo sapiens origin recognition comp... 29 9.8 AF132596-1|AAD22110.1| 436|Homo sapiens origin recognition comp... 29 9.8 AF047598-1|AAC80282.1| 436|Homo sapiens origin recognition comp... 29 9.8 AF022108-1|AAC01957.1| 436|Homo sapiens putative replication in... 29 9.8 AC019226-1|AAY24232.1| 145|Homo sapiens unknown protein. 29 9.8 >U66871-1|AAC51172.1| 104|Homo sapiens enhancer of rudimentary homolog protein. Length = 104 Score = 95.9 bits (228), Expect = 1e-19 Identities = 43/62 (69%), Positives = 50/62 (80%) Frame = +2 Query: 233 EKAKP*YTTITYDISQLFDFVDQLADLSCLVYQKSTNTYAPYNKDWIKEKIYVLLRQAAG 412 ++ P +ITYDISQLFDF+D LADLSCLVY+ T TY PYNKDWIKEKIYVLLR+ A Sbjct: 41 KRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQ 100 Query: 413 QS 418 Q+ Sbjct: 101 QA 102 Score = 93.9 bits (223), Expect = 4e-19 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 114 MSHTILLVQPGPRPETRTYSDYESVNDCMEGVCKIYEEHLKRRNPNTP 257 MSHTILLVQP RPE RTY+DYESVN+CMEGVCK+YEEHLKR NPN+P Sbjct: 1 MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSP 48 >D85758-1|BAA12865.1| 104|Homo sapiens human protein homologous to DROER protein protein. Length = 104 Score = 95.9 bits (228), Expect = 1e-19 Identities = 43/62 (69%), Positives = 50/62 (80%) Frame = +2 Query: 233 EKAKP*YTTITYDISQLFDFVDQLADLSCLVYQKSTNTYAPYNKDWIKEKIYVLLRQAAG 412 ++ P +ITYDISQLFDF+D LADLSCLVY+ T TY PYNKDWIKEKIYVLLR+ A Sbjct: 41 KRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQ 100 Query: 413 QS 418 Q+ Sbjct: 101 QA 102 Score = 93.9 bits (223), Expect = 4e-19 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 114 MSHTILLVQPGPRPETRTYSDYESVNDCMEGVCKIYEEHLKRRNPNTP 257 MSHTILLVQP RPE RTY+DYESVN+CMEGVCK+YEEHLKR NPN+P Sbjct: 1 MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSP 48 >CR542178-1|CAG46975.1| 104|Homo sapiens ERH protein. Length = 104 Score = 95.9 bits (228), Expect = 1e-19 Identities = 43/62 (69%), Positives = 50/62 (80%) Frame = +2 Query: 233 EKAKP*YTTITYDISQLFDFVDQLADLSCLVYQKSTNTYAPYNKDWIKEKIYVLLRQAAG 412 ++ P +ITYDISQLFDF+D LADLSCLVY+ T TY PYNKDWIKEKIYVLLR+ A Sbjct: 41 KRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQ 100 Query: 413 QS 418 Q+ Sbjct: 101 QA 102 Score = 93.9 bits (223), Expect = 4e-19 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 114 MSHTILLVQPGPRPETRTYSDYESVNDCMEGVCKIYEEHLKRRNPNTP 257 MSHTILLVQP RPE RTY+DYESVN+CMEGVCK+YEEHLKR NPN+P Sbjct: 1 MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSP 48 >CR450298-1|CAG29294.1| 104|Homo sapiens ERH protein. Length = 104 Score = 95.9 bits (228), Expect = 1e-19 Identities = 43/62 (69%), Positives = 50/62 (80%) Frame = +2 Query: 233 EKAKP*YTTITYDISQLFDFVDQLADLSCLVYQKSTNTYAPYNKDWIKEKIYVLLRQAAG 412 ++ P +ITYDISQLFDF+D LADLSCLVY+ T TY PYNKDWIKEKIYVLLR+ A Sbjct: 41 KRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQ 100 Query: 413 QS 418 Q+ Sbjct: 101 QA 102 Score = 93.9 bits (223), Expect = 4e-19 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 114 MSHTILLVQPGPRPETRTYSDYESVNDCMEGVCKIYEEHLKRRNPNTP 257 MSHTILLVQP RPE RTY+DYESVN+CMEGVCK+YEEHLKR NPN+P Sbjct: 1 MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSP 48 >BT006877-1|AAP35523.1| 104|Homo sapiens enhancer of rudimentary homolog (Drosophila) protein. Length = 104 Score = 95.9 bits (228), Expect = 1e-19 Identities = 43/62 (69%), Positives = 50/62 (80%) Frame = +2 Query: 233 EKAKP*YTTITYDISQLFDFVDQLADLSCLVYQKSTNTYAPYNKDWIKEKIYVLLRQAAG 412 ++ P +ITYDISQLFDF+D LADLSCLVY+ T TY PYNKDWIKEKIYVLLR+ A Sbjct: 41 KRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQ 100 Query: 413 QS 418 Q+ Sbjct: 101 QA 102 Score = 93.9 bits (223), Expect = 4e-19 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 114 MSHTILLVQPGPRPETRTYSDYESVNDCMEGVCKIYEEHLKRRNPNTP 257 MSHTILLVQP RPE RTY+DYESVN+CMEGVCK+YEEHLKR NPN+P Sbjct: 1 MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSP 48 >BC071709-1|AAH71709.1| 104|Homo sapiens enhancer of rudimentary homolog (Drosophila) protein. Length = 104 Score = 95.9 bits (228), Expect = 1e-19 Identities = 43/62 (69%), Positives = 50/62 (80%) Frame = +2 Query: 233 EKAKP*YTTITYDISQLFDFVDQLADLSCLVYQKSTNTYAPYNKDWIKEKIYVLLRQAAG 412 ++ P +ITYDISQLFDF+D LADLSCLVY+ T TY PYNKDWIKEKIYVLLR+ A Sbjct: 41 KRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQ 100 Query: 413 QS 418 Q+ Sbjct: 101 QA 102 Score = 93.9 bits (223), Expect = 4e-19 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 114 MSHTILLVQPGPRPETRTYSDYESVNDCMEGVCKIYEEHLKRRNPNTP 257 MSHTILLVQP RPE RTY+DYESVN+CMEGVCK+YEEHLKR NPN+P Sbjct: 1 MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSP 48 >BC014301-1|AAH14301.1| 104|Homo sapiens enhancer of rudimentary homolog (Drosophila) protein. Length = 104 Score = 95.9 bits (228), Expect = 1e-19 Identities = 43/62 (69%), Positives = 50/62 (80%) Frame = +2 Query: 233 EKAKP*YTTITYDISQLFDFVDQLADLSCLVYQKSTNTYAPYNKDWIKEKIYVLLRQAAG 412 ++ P +ITYDISQLFDF+D LADLSCLVY+ T TY PYNKDWIKEKIYVLLR+ A Sbjct: 41 KRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQ 100 Query: 413 QS 418 Q+ Sbjct: 101 QA 102 Score = 93.9 bits (223), Expect = 4e-19 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 114 MSHTILLVQPGPRPETRTYSDYESVNDCMEGVCKIYEEHLKRRNPNTP 257 MSHTILLVQP RPE RTY+DYESVN+CMEGVCK+YEEHLKR NPN+P Sbjct: 1 MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSP 48 >BC014847-1|AAH14847.1| 436|Homo sapiens origin recognition complex, subunit 4-like (yeast) protein. Length = 436 Score = 29.5 bits (63), Expect = 9.8 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +1 Query: 235 KGETLIHHY---HVRYITTLRFCRPVGRSELFSLSEIYKHIRTLQQR 366 K +LIH V+ I RFCR S LF + YKH+ L +R Sbjct: 7 KSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKR 53 >AY600302-1|AAS94326.1| 436|Homo sapiens origin recognition complex, subunit 4-like (yeast) protein. Length = 436 Score = 29.5 bits (63), Expect = 9.8 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +1 Query: 235 KGETLIHHY---HVRYITTLRFCRPVGRSELFSLSEIYKHIRTLQQR 366 K +LIH V+ I RFCR S LF + YKH+ L +R Sbjct: 7 KSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKR 53 >AF132596-1|AAD22110.1| 436|Homo sapiens origin recognition complex subunit 4 protein. Length = 436 Score = 29.5 bits (63), Expect = 9.8 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +1 Query: 235 KGETLIHHY---HVRYITTLRFCRPVGRSELFSLSEIYKHIRTLQQR 366 K +LIH V+ I RFCR S LF + YKH+ L +R Sbjct: 7 KSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKR 53 >AF047598-1|AAC80282.1| 436|Homo sapiens origin recognition complex subunit 4 protein. Length = 436 Score = 29.5 bits (63), Expect = 9.8 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +1 Query: 235 KGETLIHHY---HVRYITTLRFCRPVGRSELFSLSEIYKHIRTLQQR 366 K +LIH V+ I RFCR S LF + YKH+ L +R Sbjct: 7 KSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKR 53 >AF022108-1|AAC01957.1| 436|Homo sapiens putative replication initiator origin recognition complex subunit Orc4Lp protein. Length = 436 Score = 29.5 bits (63), Expect = 9.8 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +1 Query: 235 KGETLIHHY---HVRYITTLRFCRPVGRSELFSLSEIYKHIRTLQQR 366 K +LIH V+ I RFCR S LF + YKH+ L +R Sbjct: 7 KSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKR 53 >AC019226-1|AAY24232.1| 145|Homo sapiens unknown protein. Length = 145 Score = 29.5 bits (63), Expect = 9.8 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +1 Query: 235 KGETLIHHY---HVRYITTLRFCRPVGRSELFSLSEIYKHIRTLQQR 366 K +LIH V+ I RFCR S LF + YKH+ L +R Sbjct: 7 KSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKR 53 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,537,657 Number of Sequences: 237096 Number of extensions: 1755420 Number of successful extensions: 2800 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2799 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6522878360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -