BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0178 (602 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q1F0H6 Cluster: Putative uncharacterized protein precur... 33 6.9 UniRef50_Q6JCT2 Cluster: NADH-ubiquinone oxidoreductase chain 1;... 32 9.1 >UniRef50_Q1F0H6 Cluster: Putative uncharacterized protein precursor; n=1; Clostridium oremlandii OhILAs|Rep: Putative uncharacterized protein precursor - Clostridium oremlandii OhILAs Length = 302 Score = 32.7 bits (71), Expect = 6.9 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = -3 Query: 411 YIMFPLAKLVCSDIYNYNSYWTFFMDFEDKVIDHI 307 ++ P+ KLV S IYNYN Y+TF E+ I I Sbjct: 234 FLQAPM-KLVGSKIYNYNEYYTFIYSHEEGNITRI 267 >UniRef50_Q6JCT2 Cluster: NADH-ubiquinone oxidoreductase chain 1; n=14; Aleyrodidae|Rep: NADH-ubiquinone oxidoreductase chain 1 - Aleurodicus dispersus Length = 318 Score = 32.3 bits (70), Expect = 9.1 Identities = 23/78 (29%), Positives = 42/78 (53%) Frame = -3 Query: 510 LLQVFNTKIEVFSNLWSEVFYSVLE*TNGN*MIYIMFPLAKLVCSDIYNYNSYWTFFMDF 331 +LQ F+ I++FS + F S N +IY MFPL ++CS + + Y F+ +F Sbjct: 46 ILQPFSDAIKLFSKEMNLNFKS-------NYIIYYMFPLLNIICS-LMMWMIY-PFYWNF 96 Query: 330 EDKVIDHILLFFLVSVNI 277 + ++L ++S+N+ Sbjct: 97 NFNKFNILMLMSMMSINM 114 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 507,923,893 Number of Sequences: 1657284 Number of extensions: 8776035 Number of successful extensions: 16181 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15736 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16179 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 42732687689 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -