BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0178 (602 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT029425-1|ABK57082.1| 389|Drosophila melanogaster IP03021p pro... 28 8.5 AE014134-888|AAF52225.1| 501|Drosophila melanogaster CG6081-PA ... 28 8.5 >BT029425-1|ABK57082.1| 389|Drosophila melanogaster IP03021p protein. Length = 389 Score = 28.3 bits (60), Expect = 8.5 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 7/38 (18%) Frame = -3 Query: 534 TPTLCLQ*LLQVFNTKIE-----VFSNLWSEV--FYSV 442 TPT L+ + +VFNT E V +NLW +V FYSV Sbjct: 95 TPTPLLKMIKRVFNTSFEFIFYSVVTNLWQKVRKFYSV 132 >AE014134-888|AAF52225.1| 501|Drosophila melanogaster CG6081-PA protein. Length = 501 Score = 28.3 bits (60), Expect = 8.5 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 7/38 (18%) Frame = -3 Query: 534 TPTLCLQ*LLQVFNTKIE-----VFSNLWSEV--FYSV 442 TPT L+ + +VFNT E V +NLW +V FYSV Sbjct: 207 TPTPLLKMIKRVFNTSFEFIFYSVVTNLWQKVRKFYSV 244 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,384,684 Number of Sequences: 53049 Number of extensions: 387406 Number of successful extensions: 554 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 554 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2462276481 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -