BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0176 (744 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q3EBU5 Cluster: Uncharacterized protein At2g24600.3; n=... 33 7.4 >UniRef50_Q3EBU5 Cluster: Uncharacterized protein At2g24600.3; n=4; Arabidopsis thaliana|Rep: Uncharacterized protein At2g24600.3 - Arabidopsis thaliana (Mouse-ear cress) Length = 601 Score = 33.1 bits (72), Expect = 7.4 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = -2 Query: 470 MMNNNPKFKIFLFMKSLCIFQSVCIFLLVTRLVPNKDK 357 ++ N FK+F ++ +F S+CI +L+ ++P + K Sbjct: 441 LVGNTAAFKVFAICNNIALFTSLCIVILLVSIIPYQRK 478 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 562,683,169 Number of Sequences: 1657284 Number of extensions: 9452736 Number of successful extensions: 18302 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 17791 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18300 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 60911752460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -