BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0176 (744 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81484-9|CAE11297.1| 325|Caenorhabditis elegans Hypothetical pr... 28 6.1 AF026204-3|AAB71253.1| 424|Caenorhabditis elegans Hypothetical ... 28 8.0 >Z81484-9|CAE11297.1| 325|Caenorhabditis elegans Hypothetical protein C47A10.10 protein. Length = 325 Score = 28.3 bits (60), Expect = 6.1 Identities = 18/43 (41%), Positives = 28/43 (65%), Gaps = 2/43 (4%) Frame = +2 Query: 599 M*FNKFKI-VVVFYALFSFNVNKSIT-INGIVNNDTRYLLMSF 721 M F+KF I ++VF L +N+NKSI+ I +V+ +T + SF Sbjct: 195 MLFSKFLIQLLVFVVLIRWNMNKSISEIKSMVSKNTFRMHKSF 237 >AF026204-3|AAB71253.1| 424|Caenorhabditis elegans Hypothetical protein C30E1.8 protein. Length = 424 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 256 KMNIRKPYSKKVRELEETLDLLE-VHVLISN*FEN 155 ++N PYS+ V + E +LLE + V + N +EN Sbjct: 14 ELNAEPPYSRYVAAVMEDYELLEQIRVFVGNEYEN 48 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,752,951 Number of Sequences: 27780 Number of extensions: 250329 Number of successful extensions: 570 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 570 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1756472266 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -