BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0176 (744 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 7.0 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 7.0 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 7.0 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 7.0 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -3 Query: 268 FRFLKMNIRKPYSKKVRELEETLDLLEVHVLISN*FENH 152 FR L +I +PY + + + + D+ E +V +N E H Sbjct: 273 FRLLMNDILRPYVPEFKGVLDVKDVEEGNVEETNSEETH 311 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.8 bits (44), Expect = 7.0 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -3 Query: 268 FRFLKMNIRKPYSKKVRELEETLDLLEVHVLISN*FENH 152 FR L +I +PY + + + + D+ E +V +N E H Sbjct: 188 FRLLMNDILRPYVPEFKGVLDVKDVEEGNVEETNSEETH 226 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 7.0 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -3 Query: 268 FRFLKMNIRKPYSKKVRELEETLDLLEVHVLISN*FENH 152 FR L +I +PY + + + + D+ E +V +N E H Sbjct: 507 FRLLMNDILRPYVPEFKGVLDVKDVEEGNVEETNSEETH 545 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,381 Number of Sequences: 438 Number of extensions: 2977 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -