BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0173 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 6.5 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 21 6.5 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +1 Query: 286 VSLAEWISWYQTPRSI 333 V++ + I W Q PR+I Sbjct: 456 VTMTQVIQWIQNPRTI 471 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.0 bits (42), Expect = 6.5 Identities = 15/64 (23%), Positives = 28/64 (43%) Frame = +1 Query: 223 EGVVCHVANHDIGDDYLKWPQVSLAEWISWYQTPRSIQRWLRS*IVSTNGGIYTSNSLEG 402 EG + H+A H + +L + W+SW + + + L S N G++ S Sbjct: 363 EGWIHHLARHAVAC-FLTRGDL----WLSWEEGMKVFEELLLDADWSVNAGMWMWLSCSS 417 Query: 403 YLEQ 414 + +Q Sbjct: 418 FFQQ 421 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,593 Number of Sequences: 336 Number of extensions: 2244 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -