BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0170 (772 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1861.01c |cnp3|SPBC56F2.13|CENP-C|Schizosaccharomyces pombe|... 27 3.0 SPAC13G7.13c |msa1|SPAC6C3.01c|RNA-binding protein Msa1|Schizosa... 25 9.1 >SPBC1861.01c |cnp3|SPBC56F2.13|CENP-C|Schizosaccharomyces pombe|chr 2|||Manual Length = 643 Score = 27.1 bits (57), Expect = 3.0 Identities = 16/48 (33%), Positives = 20/48 (41%) Frame = +1 Query: 541 DCDSGPCRDDPPRATHLLNHLHPQLVRARV*SGKHASLADTGTDNPRV 684 D D+G D P T L P V A HAS +D+ NP + Sbjct: 59 DEDNGDIEQDMPPVTRL-QPTSPMAVNAASDEASHASSSDSSDKNPDI 105 >SPAC13G7.13c |msa1|SPAC6C3.01c|RNA-binding protein Msa1|Schizosaccharomyces pombe|chr 1|||Manual Length = 533 Score = 25.4 bits (53), Expect = 9.1 Identities = 20/79 (25%), Positives = 30/79 (37%), Gaps = 12/79 (15%) Frame = +3 Query: 561 PRRPTPRYPSIEPFAPPISARQSL------------KRQTCVPGRYRN*QPESLMPVGHP 704 P P P +P+ PF+PP +A + T PG P+S P+ P Sbjct: 454 PSYPYPMFPA--PFSPPRNAMMPIPAPMDQFSTFHQSMATLPPGAVPTSIPQSYYPIYSP 511 Query: 705 TLNFHSSICMSFYIHCSPV 761 + S +Y H P+ Sbjct: 512 EMAMPQSYSPMYYTHNPPM 530 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,855,365 Number of Sequences: 5004 Number of extensions: 55609 Number of successful extensions: 96 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 371330890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -