BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0170 (772 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 22 7.3 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 7.3 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 7.3 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 9.6 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 7.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 247 YTKLRSFTYRLRHYEVCQVSKLLIKILRYGRFFPAR 354 Y KL YR +Y + + ++ I + Y FP R Sbjct: 96 YKKLYCNNYRKLYYNINYIEQIPIPVPIYCGNFPPR 131 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 7.3 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 552 RSVPRRPTPRYPSIEPFAPPISARQS 629 +S+PRR S+ PPIS ++ Sbjct: 1836 KSLPRRGRSSRSSLRTLLPPISVAET 1861 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 7.3 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 552 RSVPRRPTPRYPSIEPFAPPISARQS 629 +S+PRR S+ PPIS ++ Sbjct: 1832 KSLPRRGRSSRSSLRTLLPPISVAET 1857 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +2 Query: 326 YVTDVFSRLGYPSADSHKELRSNK 397 +V+D Y D HKEL K Sbjct: 473 FVSDAVMAFAYAFRDMHKELCDGK 496 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,658 Number of Sequences: 438 Number of extensions: 4174 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -