BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0165 (449 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 22 2.7 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 2.7 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 2.7 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 3.6 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 4.7 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 8.2 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 8.2 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 22.2 bits (45), Expect = 2.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 61 MTDEFFYGVTLSSSHQSETW 120 M+DE YG+ + S Q+ +W Sbjct: 209 MSDELGYGLIVYSWEQNRSW 228 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 2.7 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +1 Query: 58 IMTDEFFYGVTLSSSHQSETWDPEAKAEYPRSNKLV 165 + TD ++SSS +++ W P+ E N L+ Sbjct: 367 LRTDISSSSSSISSSEENDFWQPKPTLEDAPQNSLL 402 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 2.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 54 NHHDGRVFLWCHPFIITS 107 +H+DGR+ W P ++ S Sbjct: 274 DHNDGRLRYWRTPSVVVS 291 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.8 bits (44), Expect = 3.6 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 162 RHSSSIVRSRCQTR*IKCDTGG 227 +H SS + C ++C TGG Sbjct: 282 QHRSSSASTTCSGHTVRCFTGG 303 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.4 bits (43), Expect = 4.7 Identities = 24/86 (27%), Positives = 37/86 (43%), Gaps = 4/86 (4%) Frame = +3 Query: 72 VFLWCHPFIITSVRDMGSRGKSRIPTQQQARHSSSIVRSRCQTR*IKCDTGGSHVTTRSS 251 VF F++ V D+ S+ + + T +RH S TR I + G S S+ Sbjct: 273 VFAALGEFVVVKVLDLRSQLEYDLQTSIMSRHYS--------TRAIVIEKGQSIWDYDST 324 Query: 252 KLPVAVLKVGESRHVR----LDIEFP 317 +P K S+H+ LD E+P Sbjct: 325 YIPKVKNKKAGSKHLLQNTWLDPEYP 350 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 20.6 bits (41), Expect = 8.2 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -1 Query: 209 NSSGLASGPNNA*RMTSLLLRGYSAFASGS 120 N G + PN+A R + G A SGS Sbjct: 576 NDEGGKTSPNSAVRKCMSPINGSGASGSGS 605 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 20.6 bits (41), Expect = 8.2 Identities = 9/31 (29%), Positives = 12/31 (38%) Frame = +2 Query: 77 SMVSPFHHHISQRHGIQRQKQNTHAATSSSF 169 +M P HHH Q +Q S S+ Sbjct: 346 TMGPPHHHHHHQTQSLQHLHYRQPPTLSESY 376 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,604 Number of Sequences: 438 Number of extensions: 2434 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -