BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0159 (399 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 24 0.74 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 21 3.9 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 5.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 5.2 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 20 9.1 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 20 9.1 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.8 bits (49), Expect = 0.74 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = -1 Query: 390 TLYATLILGLPPSLTTSKCQCFMSACTVASSNLRPMRRLASNIVLWGSSPP 238 T +A LPP FMS CTV + M NIVL S P Sbjct: 289 TQHAKSQASLPPVSYLKAVDAFMSVCTVFVF-MALMEYCLVNIVLGDSDTP 338 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 21.4 bits (43), Expect = 3.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 69 PFCIFNQSCYLFLKQ 25 P+C N SCY LK+ Sbjct: 9 PYCRRNFSCYYSLKR 23 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 5.2 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = +2 Query: 206 RASHRRCRQEPGGDEPHNTIFDAKRLIGRKFEDATVQADMKHWHFEVVSD 355 R +R +Q PG E + D +L + E + K H VSD Sbjct: 1767 RRRQQRKQQTPGDVESDESESDPDQLTSSRTESSNQLDAGKLKHIRAVSD 1816 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.0 bits (42), Expect = 5.2 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = +2 Query: 206 RASHRRCRQEPGGDEPHNTIFDAKRLIGRKFEDATVQADMKHWHFEVVSD 355 R +R +Q PG E + D +L + E + K H VSD Sbjct: 1763 RRRQQRKQQTPGDVESDESESDPDQLTSSRTESSNQLDAGKLKHIRAVSD 1812 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 20.2 bits (40), Expect = 9.1 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -3 Query: 394 LHPICYLDLRVASITDNLEMPVLHVGLHSSI 302 LH C LD++ + ++MP L V S+ Sbjct: 284 LHLFCLLDVQWRIPFNGIQMPNLMVFYEKSL 314 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 20.2 bits (40), Expect = 9.1 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +2 Query: 341 EVVSDGGNPKIKVAYRV 391 E ++ GG+ K ++AYR+ Sbjct: 69 EFLNPGGSVKDRIAYRM 85 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,040 Number of Sequences: 438 Number of extensions: 2926 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9885360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -