BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0158 (464 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2G2.06c |apl1||AP-2 adaptor complex subunit Apl1 |Schizosacc... 26 2.5 SPCC4G3.05c |mus81||Holliday junction resolvase subunit Mus81|Sc... 25 5.7 >SPBC2G2.06c |apl1||AP-2 adaptor complex subunit Apl1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 677 Score = 26.2 bits (55), Expect = 2.5 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = +2 Query: 95 KVKKNIFFFLNILVS*RDLQAKRRA*VLFNEVYEKYAVI 211 ++KK + +L I S + +AKR ++ N++Y +I Sbjct: 65 ELKKLCYLYLKIYASVKPTEAKRAVKLILNDIYSSNPMI 103 >SPCC4G3.05c |mus81||Holliday junction resolvase subunit Mus81|Schizosaccharomyces pombe|chr 3|||Manual Length = 608 Score = 25.0 bits (52), Expect = 5.7 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 4/39 (10%) Frame = -2 Query: 145 SLRDQYIKKKKNVLFYFSFH*FKNV----STFVNFDIFI 41 SLR+Q +K + ++ S+H F +V ST DIFI Sbjct: 498 SLREQLLKIDPSTPYHISYHAFSSVLSKSSTLTVGDIFI 536 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,584,485 Number of Sequences: 5004 Number of extensions: 28531 Number of successful extensions: 70 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 176367270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -