BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0157 (451 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY118497-1|AAM49866.1| 450|Drosophila melanogaster LD07917p pro... 31 0.94 AE014298-1517|AAF47969.1| 450|Drosophila melanogaster CG1637-PC... 31 0.94 AF239667-1|AAF43091.1| 356|Drosophila melanogaster putative RNA... 29 3.8 AE014298-1827|AAF48215.3| 356|Drosophila melanogaster CG4396-PA... 29 3.8 >AY118497-1|AAM49866.1| 450|Drosophila melanogaster LD07917p protein. Length = 450 Score = 30.7 bits (66), Expect = 0.94 Identities = 17/60 (28%), Positives = 27/60 (45%) Frame = +3 Query: 264 SLFFFYNLNEVNNVQCCEFYYYFVFCSVVTIKEQCKTIWRMAAATQIPMCHRPNSWSITY 443 SL++ +NL V+ V YYF+ + +Q + + R A +P W ITY Sbjct: 234 SLWYSFNLGPVHFVSFSTEVYYFLSYGFKLLTKQFEWLERDLAEANLPENRAKRPWIITY 293 >AE014298-1517|AAF47969.1| 450|Drosophila melanogaster CG1637-PC, isoform C protein. Length = 450 Score = 30.7 bits (66), Expect = 0.94 Identities = 17/60 (28%), Positives = 27/60 (45%) Frame = +3 Query: 264 SLFFFYNLNEVNNVQCCEFYYYFVFCSVVTIKEQCKTIWRMAAATQIPMCHRPNSWSITY 443 SL++ +NL V+ V YYF+ + +Q + + R A +P W ITY Sbjct: 234 SLWYSFNLGPVHFVSFSTEVYYFLSYGFKLLTKQFEWLERDLAEANLPENRAKRPWIITY 293 >AF239667-1|AAF43091.1| 356|Drosophila melanogaster putative RNA binding protein protein. Length = 356 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 347 SNNKRTMQNDMENGGGDANTNVSPTKLMVNYIPE 448 +N ++N NG D + + S T L+VNY+P+ Sbjct: 2 TNAMDIVKNGSANGSVDGSNDESRTNLIVNYLPQ 35 >AE014298-1827|AAF48215.3| 356|Drosophila melanogaster CG4396-PA protein. Length = 356 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 347 SNNKRTMQNDMENGGGDANTNVSPTKLMVNYIPE 448 +N ++N NG D + + S T L+VNY+P+ Sbjct: 2 TNAMDIVKNGSANGSVDGSNDESRTNLIVNYLPQ 35 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,574,096 Number of Sequences: 53049 Number of extensions: 401139 Number of successful extensions: 1228 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1203 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1228 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1455824790 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -