BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0154 (523 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 25 0.62 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 24 1.1 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 7.7 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 24.6 bits (51), Expect = 0.62 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 152 DKNDGEKEAEMKFQKLKEAKEILCDP-SKRALYDK 253 +KN G + MK +K + A+E + DP + YD+ Sbjct: 145 EKNAGNNKITMKSKKEQNAEEDIVDPVEENETYDE 179 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 23.8 bits (49), Expect = 1.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 448 SGTLGTGNQEPPLRSSPSFAI 510 S T GTG + P + PSF I Sbjct: 393 SSTPGTGREHDPAKFPPSFRI 413 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/36 (19%), Positives = 21/36 (58%) Frame = +2 Query: 125 KILALQHHPDKNDGEKEAEMKFQKLKEAKEILCDPS 232 K++ L+H ++ + ++K ++K +++ DP+ Sbjct: 653 KLMMLKHREFRSSIKASDKLKDSRIKTTEKLSTDPN 688 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,128 Number of Sequences: 438 Number of extensions: 2924 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -