BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0143 (696 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0171 - 1268803-1269500,1271491-1271567,1271941-1272065,127... 29 2.7 01_06_0381 + 28878811-28879120,28880189-28880331,28880753-288815... 29 3.5 01_06_1792 - 39912714-39913559 29 4.7 >12_01_0171 - 1268803-1269500,1271491-1271567,1271941-1272065, 1272146-1272234,1272851-1272936,1273509-1273765 Length = 443 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/55 (27%), Positives = 27/55 (49%) Frame = +1 Query: 292 RDPQDYTALNERKSQDKHTENLIPNLTNSHKSYGYTGIDKDESIVSQDKVAFTND 456 ++PQ AL+E D +EN + L++S + T D +E + + D N+ Sbjct: 264 QEPQVVPALHEEPQDDDRSENAVQELSSSEAN---TSSDNNEPLAADDSAECMNE 315 >01_06_0381 + 28878811-28879120,28880189-28880331,28880753-28881532, 28882568-28883968 Length = 877 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/51 (25%), Positives = 22/51 (43%) Frame = +1 Query: 193 QHSRSWRPNHRKTKP*STS*PRNVENPSQRPEHRDPQDYTALNERKSQDKH 345 +HS+ P H + + S+ + R HRD Y +E +S +H Sbjct: 762 RHSKDLEPRHHRHRDSSSEDEHEHRSSKSRHRHRDDYHYHEDDEHRSSHRH 812 >01_06_1792 - 39912714-39913559 Length = 281 Score = 28.7 bits (61), Expect = 4.7 Identities = 25/88 (28%), Positives = 42/88 (47%) Frame = +1 Query: 241 STS*PRNVENPSQRPEHRDPQDYTALNERKSQDKHTENLIPNLTNSHKSYGYTGIDKDES 420 S+S PR + + + +D Q YT+ N D + +T+SHK + +KD + Sbjct: 28 SSSPPRGAGDKKET-KTKDYQSYTSNNNNNGSDDDKDKNKHKITSSHK---HKDDEKDRN 83 Query: 421 IVSQDKVAFTNDNGNLYQSKESRSENSG 504 S+D + N + Y +K+S NSG Sbjct: 84 NHSKD--SHGGGNSSNY-NKDSYGGNSG 108 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,388,858 Number of Sequences: 37544 Number of extensions: 319485 Number of successful extensions: 610 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 602 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 610 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -