BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0142 (741 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0) 96 3e-20 SB_12261| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_8902| Best HMM Match : DUF1070 (HMM E-Value=0.76) 30 2.3 SB_44412| Best HMM Match : DUF1070 (HMM E-Value=0.76) 30 2.3 SB_11417| Best HMM Match : zf-TAZ (HMM E-Value=0.91) 29 5.2 SB_52374| Best HMM Match : GATase_2 (HMM E-Value=0) 28 9.1 SB_18635| Best HMM Match : 7tm_1 (HMM E-Value=8.54792e-44) 28 9.1 >SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0) Length = 268 Score = 95.9 bits (228), Expect = 3e-20 Identities = 49/136 (36%), Positives = 77/136 (56%), Gaps = 2/136 (1%) Frame = +2 Query: 332 LYLCSGLGITAGAHRLWAHKSYKARLPLRILLTIFNTIAFQDAVVDWARDHRMHHKYSEP 511 L LC G G+T GAHRLWAH+++KA+ PLR+++ + N++A Q+ + +W+RDHR+HHKYSE Sbjct: 12 LSLCRGYGVTIGAHRLWAHRTFKAKWPLRLVIMLMNSMAAQNDIFEWSRDHRVHHKYSET 71 Query: 512 MRTPTTQPEDSSFPTLAGCC*GSIPK--SKPKAIPST*MICAMILSYVFRRSTTKF*CL* 685 P F + P K K I + + ++ +F+R K + Sbjct: 72 DADPHNAKRGFFFSHVGWLMQRKHPDVIRKGKGIDLSDLYADSVV--MFQRRHYKKISML 129 Query: 686 PVFIMPTYVPTLWGRN 733 ++PT VP+LWG + Sbjct: 130 MCVLIPTLVPSLWGES 145 >SB_12261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -1 Query: 624 IIH-VDGMAFGFDFGMLPQQQPANVGKEESSGCVVG 520 ++H V G FG DF PAN G E S C VG Sbjct: 339 VVHGVRGGVFGEDFAQHLAPNPANTGDEASYDCGVG 374 >SB_8902| Best HMM Match : DUF1070 (HMM E-Value=0.76) Length = 544 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -1 Query: 624 IIH-VDGMAFGFDFGMLPQQQPANVGKEESSGCVVG 520 ++H V G FG DF PAN G E S C VG Sbjct: 305 VVHGVRGGVFGEDFAQHLAPNPANTGDEASYDCGVG 340 >SB_44412| Best HMM Match : DUF1070 (HMM E-Value=0.76) Length = 632 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -1 Query: 624 IIH-VDGMAFGFDFGMLPQQQPANVGKEESSGCVVG 520 ++H V G FG DF PAN G E S C VG Sbjct: 541 VVHGVRGGVFGEDFAQHLAPNPANTGDEASYDCGVG 576 >SB_11417| Best HMM Match : zf-TAZ (HMM E-Value=0.91) Length = 390 Score = 28.7 bits (61), Expect = 5.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 615 VDGMAFGFDFGMLPQQQPANVGKEESSGCVVG 520 V G FG DF PAN G E S C VG Sbjct: 155 VRGGVFGEDFAQHLAPNPANTGDEASYDCGVG 186 >SB_52374| Best HMM Match : GATase_2 (HMM E-Value=0) Length = 1075 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -2 Query: 596 ALISGCFLNNNQPMWEKKNPRVALWGSASALNICG 492 A++ G F N P WE+ +P L + ICG Sbjct: 548 AIVHGRFSTNTFPSWERAHPNRYLAHNGEINTICG 582 >SB_18635| Best HMM Match : 7tm_1 (HMM E-Value=8.54792e-44) Length = 350 Score = 27.9 bits (59), Expect = 9.1 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +2 Query: 314 SIFAIFLYLCSGLGITAGAHRLWAHKSY 397 ++F I + LG+++ H WAHK+Y Sbjct: 148 AVFVIIVAWALALGVSSLIHVTWAHKAY 175 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,790,743 Number of Sequences: 59808 Number of extensions: 639721 Number of successful extensions: 1762 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1757 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1998111622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -