BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0140 (721 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 26 0.31 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 26 0.31 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 26 0.31 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 26 0.31 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 25 0.54 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 25 0.54 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 25 0.54 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 25 0.54 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 25 0.54 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 25 0.54 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 25 0.54 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 25 0.54 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 25 0.72 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 25 0.95 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 24 1.3 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 24 1.3 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 24 1.3 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 24 1.3 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 24 1.3 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 24 1.3 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 24 1.3 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 24 1.3 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 24 1.3 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 24 1.3 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 24 1.7 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 24 1.7 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 24 1.7 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 24 1.7 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 24 1.7 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 24 1.7 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 24 1.7 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 24 1.7 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 24 1.7 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 24 1.7 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 23 2.2 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 23 2.2 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 23 2.2 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 23 2.2 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 23 2.2 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 23 2.2 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 23 2.2 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 2.2 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 23 2.9 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 23 2.9 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 23 2.9 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 23 2.9 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 23 2.9 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 23 2.9 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 23 3.8 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 23 3.8 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 23 3.8 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 23 3.8 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 23 3.8 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 22 5.1 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 5.1 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 5.1 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 5.1 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 5.1 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 5.1 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 5.1 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 5.1 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 5.1 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 5.1 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 22 6.7 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 8.9 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 8.9 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 8.9 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 8.9 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 8.9 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 8.9 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 26.2 bits (55), Expect = 0.31 Identities = 12/53 (22%), Positives = 28/53 (52%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + E + ++E++ K+ ER + + + + N + N Sbjct: 41 RSREREQKSYKNEREYREYRETSRERSRDRKERERSKEPKIISSLSNNYKYSN 93 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 26.2 bits (55), Expect = 0.31 Identities = 12/53 (22%), Positives = 28/53 (52%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + E + ++E++ K+ ER + + + + N + N Sbjct: 41 RSREREQKSYKNEREYREYRETSRERSRDRKERERSKEPKIISSLSNNYKYSN 93 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 26.2 bits (55), Expect = 0.31 Identities = 12/53 (22%), Positives = 28/53 (52%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + E + ++E++ K+ ER + + + + N + N Sbjct: 41 RSREREQKSYKNEREYREYRETSRERSRDRKERERSKEPKIISSLSNNYKYSN 93 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 26.2 bits (55), Expect = 0.31 Identities = 12/53 (22%), Positives = 28/53 (52%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + E + ++E++ K+ ER + + + + N + N Sbjct: 41 RSREREQKSYKNEREYREYRETSRERSRDRKERERSKEPKIISSLSNNYKYSN 93 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.4 bits (53), Expect = 0.54 Identities = 14/62 (22%), Positives = 29/62 (46%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS*QK 276 + +ER+Q +YK + K +KE++ + ER + + + + N N + K Sbjct: 41 RSREREQKSYKNENSYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNNNYK 100 Query: 277 RL 282 +L Sbjct: 101 QL 102 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.4 bits (53), Expect = 0.54 Identities = 14/62 (22%), Positives = 29/62 (46%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS*QK 276 + +ER+Q +YK + K +KE++ + ER + + + + N N + K Sbjct: 41 RSREREQKSYKNENSYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNNNYK 100 Query: 277 RL 282 +L Sbjct: 101 QL 102 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.4 bits (53), Expect = 0.54 Identities = 14/62 (22%), Positives = 29/62 (46%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS*QK 276 + +ER+Q +YK + K +KE++ + ER + + + + N N + K Sbjct: 41 RSREREQKSYKNENSYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNNNYK 100 Query: 277 RL 282 +L Sbjct: 101 QL 102 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.4 bits (53), Expect = 0.54 Identities = 14/62 (22%), Positives = 29/62 (46%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS*QK 276 + +ER+Q +YK + K +KE++ + ER + + + + N N + K Sbjct: 41 RSREREQKSYKNENSYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNNNYK 100 Query: 277 RL 282 +L Sbjct: 101 QL 102 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.4 bits (53), Expect = 0.54 Identities = 14/62 (22%), Positives = 29/62 (46%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS*QK 276 + +ER+Q +YK + K +KE++ + ER + + + + N N + K Sbjct: 41 RSREREQKSYKNENSYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNNNYK 100 Query: 277 RL 282 +L Sbjct: 101 QL 102 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.4 bits (53), Expect = 0.54 Identities = 14/62 (22%), Positives = 29/62 (46%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS*QK 276 + +ER+Q +YK + K +KE++ + ER + + + + N N + K Sbjct: 41 RSREREQKSYKNENSYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNNNYK 100 Query: 277 RL 282 +L Sbjct: 101 QL 102 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 25.4 bits (53), Expect = 0.54 Identities = 12/53 (22%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + +KE++ K+ ER + + + + N + N Sbjct: 41 RSREREQKSYKNENSYRKYRETSKERSRDRKERERSKEPKIISSLSNNYKYSN 93 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 25.4 bits (53), Expect = 0.54 Identities = 12/53 (22%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + +KE++ K+ ER + + + + N + N Sbjct: 274 RSREREQKSYKNENSYRKYRETSKERSRDRKERERSKEPKIISSLSNNYKYSN 326 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.0 bits (52), Expect = 0.72 Identities = 14/63 (22%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEA-RTQNTKKS*Q 273 + +ER+Q +YK + + + +KE+ ++ ER + + + + N+ N K+ Sbjct: 274 RSREREQKSYKNEREYRKYRETSKERFRDRRERERSKESKIISSLSNKTIHNNNNYKNYN 333 Query: 274 KRL 282 K+L Sbjct: 334 KKL 336 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 24.6 bits (51), Expect = 0.95 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + + +KE++ ++ ER + + + + N N Sbjct: 263 RSREREQNSYKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNSCNYSN 315 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/73 (19%), Positives = 33/73 (45%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS*QK 276 + +ER+Q +YK + + + +KE++ + ER + + + + N + N Sbjct: 41 RSREREQNSYKNEREYQKYRETSKERSRDRTERERCKEPKIISSLSNNYKYSNYNNY-NN 99 Query: 277 RLGTSYQRTMKLN 315 T+Y++ N Sbjct: 100 NYNTNYKKLQYYN 112 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/73 (19%), Positives = 33/73 (45%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS*QK 276 + +ER+Q +YK + + + +KE++ + ER + + + + N + N Sbjct: 41 RSREREQNSYKNEREYQKYRETSKERSRDRTERERCKEPKIISSLSNNYKYSNYNNY-NN 99 Query: 277 RLGTSYQRTMKLN 315 T+Y++ N Sbjct: 100 NYNTNYKKLQYYN 112 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/73 (19%), Positives = 33/73 (45%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS*QK 276 + +ER+Q +YK + + + +KE++ + ER + + + + N + N Sbjct: 41 RSREREQNSYKNEREYQKYRETSKERSRDRTERERCKEPKIISSLSNNYKYSNYNNY-NN 99 Query: 277 RLGTSYQRTMKLN 315 T+Y++ N Sbjct: 100 NYNTNYKKLQYYN 112 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/73 (19%), Positives = 33/73 (45%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS*QK 276 + +ER+Q +YK + + + +KE++ + ER + + + + N + N Sbjct: 41 RSREREQNSYKNEREYQKYRETSKERSRDRTERERCKEPKIISSLSNNYKYSNYNNY-NN 99 Query: 277 RLGTSYQRTMKLN 315 T+Y++ N Sbjct: 100 NYNTNYKKLQYYN 112 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/73 (19%), Positives = 33/73 (45%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS*QK 276 + +ER+Q +YK + + + +KE++ + ER + + + + N + N Sbjct: 41 RSREREQNSYKNEREYQKYRETSKERSRDRTERERCKEPKIISSLSNNYKYSNYNNY-NN 99 Query: 277 RLGTSYQRTMKLN 315 T+Y++ N Sbjct: 100 NYNTNYKKLQYYN 112 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/73 (19%), Positives = 33/73 (45%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS*QK 276 + +ER+Q +YK + + + +KE++ + ER + + + + N + N Sbjct: 41 RSREREQNSYKNEREYQKYRETSKERSRDRTERERCKEPKIISSLSNNYKYSNYNNY-NN 99 Query: 277 RLGTSYQRTMKLN 315 T+Y++ N Sbjct: 100 NYNTNYKKLQYYN 112 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/73 (19%), Positives = 33/73 (45%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS*QK 276 + +ER+Q +YK + + + +KE++ + ER + + + + N + N Sbjct: 41 RSREREQNSYKNEREYQKYRETSKERSRDRTERERCKEPKIISSLSNNYKYSNYNNY-NN 99 Query: 277 RLGTSYQRTMKLN 315 T+Y++ N Sbjct: 100 NYNTNYKKLQYYN 112 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/47 (21%), Positives = 27/47 (57%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARN 237 + +ER+Q +YK + + + +KE++ +++ ER + + + + N Sbjct: 41 RSREREQNSYKNEKEYRKYRERSKERSRDKRERERSKERKIISSLSN 87 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/47 (21%), Positives = 27/47 (57%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARN 237 + +ER+Q +YK + + + +KE++ +++ ER + + + + N Sbjct: 41 RSREREQNSYKNEKEYRKYRERSKERSRDKRERERSKERKIISSLSN 87 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 24.2 bits (50), Expect = 1.3 Identities = 12/53 (22%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + K +KE++ + ER + + + + N+ N Sbjct: 263 RSREREQKSYKNEREYRKYGKTSKERSRDRMERERSKEPKIISSLSNKTIHNN 315 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + + +KE++ K+ E+ + + + + N N Sbjct: 41 RSREREQNSYKNEREYRKYRETSKERSRDRKEREKSKEHKIISSLSNNYNYNN 93 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + + +KE++ K+ E+ + + + + N N Sbjct: 41 RSREREQNSYKNEREYRKYRETSKERSRDRKEREKSKEHKIISSLSNNYNYNN 93 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + + +KE++ K+ E+ + + + + N N Sbjct: 41 RSREREQNSYKNEREYRKYRETSKERSRDRKEREKSKEHKIISSLSNNYNYNN 93 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + + +KE++ ++ ER + + + + N N Sbjct: 41 RSREREQNSYKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSN 93 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + + +KE++ ++ ER + + + + N N Sbjct: 41 RSREREQNSYKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSN 93 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + + +KE++ ++ ER + + + + N N Sbjct: 41 RSREREQNSYKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSN 93 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + + +KE++ ++ ER + + + + N N Sbjct: 41 RSREREQNSYKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSN 93 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + + +KE++ ++ ER + + + + N N Sbjct: 41 RSREREQNSYKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSN 93 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + + +KE++ ++ ER + + + + N N Sbjct: 41 RSREREQNSYKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSN 93 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + + +KE++ ++ ER + + + + N N Sbjct: 41 RSREREQNSYKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSN 93 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + + +KE++ ++ ER + + + + N N Sbjct: 41 RSREREQNSYKNEREYRKYRETSKERSRDRRERERSKEPKIVSSLSNNYNYSN 93 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/56 (21%), Positives = 27/56 (48%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKK 264 + +ER+Q +YK + + + +KE++ + ER + + + + N N K Sbjct: 40 RSREREQNSYKNEREYRKYRETSKERSRDRTERERSREPKIISSLSNNTIHNNNYK 95 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/56 (21%), Positives = 27/56 (48%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKK 264 + +ER+Q +YK + + + +KE++ + ER + + + + N N K Sbjct: 40 RSREREQNSYKNEREYRKYRETSKERSRDRAERERSREPKIISSLSNNTIHNNNYK 95 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/56 (21%), Positives = 27/56 (48%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKK 264 + +ER+Q +YK + + + +KE++ + ER + + + + N N K Sbjct: 41 RSREREQNSYKNEREYRKYRETSKERSRDRTERERSREPKIISSLSNNTIHNNNYK 96 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/56 (21%), Positives = 27/56 (48%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKK 264 + +ER+Q +YK + + + +KE++ + ER + + + + N N K Sbjct: 41 RSREREQNSYKNEREYRKYRETSKERSRDRTERERSREPKIISSLSNNTIHNNNYK 96 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/56 (21%), Positives = 27/56 (48%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKK 264 + +ER+Q +YK + + + +KE++ + ER + + + + N N K Sbjct: 41 RSREREQNSYKNEREYRKYRETSKERSRDRTERERSREPKIISSLSNNTIHNNNYK 96 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/56 (21%), Positives = 27/56 (48%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKK 264 + +ER+Q +YK + + + +KE++ + ER + + + + N N K Sbjct: 41 RSREREQNSYKNEREYRKYRETSKERSRDRTERERSREPKIISSLSNNTIHNNNYK 96 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + + +KE++ + ER + + + + N + N Sbjct: 274 RSREREQKSYKNEREYRKYGETSKERSRDRTERERSKEPKIISSLSNNYKYSN 326 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.0 bits (47), Expect = 2.9 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER++ +YK + + +KE++ K+ ER + + + + N+ N Sbjct: 41 RSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNN 93 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.0 bits (47), Expect = 2.9 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER++ +YK + + +KE++ K+ ER + + + + N+ N Sbjct: 41 RSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNN 93 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 23.0 bits (47), Expect = 2.9 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER++ +YK + + +KE++ K+ ER + + + + N+ N Sbjct: 41 RSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNN 93 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.0 bits (47), Expect = 2.9 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER++ +YK + + +KE++ K+ ER + + + + N+ N Sbjct: 41 RSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNN 93 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 23.0 bits (47), Expect = 2.9 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + + +KE++ + ER + + + + N+ N Sbjct: 274 RSREREQNSYKNEREYRKYRERSKERSRDRTERERSREPKIISSLSNKTIHNN 326 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.0 bits (47), Expect = 2.9 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER++ +YK + + +KE++ K+ ER + + + + N+ N Sbjct: 274 RSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNN 326 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 22.6 bits (46), Expect = 3.8 Identities = 11/53 (20%), Positives = 26/53 (49%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + + +KE++ + ER + + + + N N Sbjct: 41 RSREREQNSYKNEREYRKYRETSKERSRDRTERERSREPKIISSLSNNYNYSN 93 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.6 bits (46), Expect = 3.8 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + + +KE++ + ER + + + + N+ N Sbjct: 41 RSREREQNSYKNEKEYRKYRETSKERSRDRTERERSREPKIISSLSNKTIHNN 93 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.8 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + + +KE++ + ER + + + + N+ N Sbjct: 41 RSREREQKSYKNERKYRKYRERSKERSRDRTERERSREPKIISSLSNKTIHNN 93 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 22.6 bits (46), Expect = 3.8 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + + +KE++ + ER + + + + N+ N Sbjct: 41 RSREREQKSYKNERKYRKYRERSKERSRDRTERERSREPKIISSLSNKTIHNN 93 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 22.6 bits (46), Expect = 3.8 Identities = 11/53 (20%), Positives = 25/53 (47%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + +KE++ + ER + + + + N N Sbjct: 274 RSREREQKSYKNENSYRKYRETSKERSRDRTERERSKERKIISSLSNNYNYNN 326 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 5.1 Identities = 11/53 (20%), Positives = 26/53 (49%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + +KE++ + ER + + + + N+ N Sbjct: 41 RSREREQKSYKNENSYRKYRETSKERSRDRTERERSREPKIISSLSNKTIHNN 93 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.1 Identities = 15/70 (21%), Positives = 30/70 (42%) Frame = +1 Query: 91 VRKQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS* 270 +++++ER+ K + + A+EK ++ R R A N ++T + Sbjct: 44 IQQEREREHERLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKL 103 Query: 271 QKRLGTSYQR 300 + GTS R Sbjct: 104 ESSDGTSLFR 113 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.1 Identities = 15/70 (21%), Positives = 30/70 (42%) Frame = +1 Query: 91 VRKQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS* 270 +++++ER+ K + + A+EK ++ R R A N ++T + Sbjct: 44 IQQEREREHERLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKL 103 Query: 271 QKRLGTSYQR 300 + GTS R Sbjct: 104 ESSDGTSLFR 113 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.1 Identities = 15/70 (21%), Positives = 30/70 (42%) Frame = +1 Query: 91 VRKQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS* 270 +++++ER+ K + + A+EK ++ R R A N ++T + Sbjct: 44 IQQEREREHERLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKL 103 Query: 271 QKRLGTSYQR 300 + GTS R Sbjct: 104 ESSDGTSLFR 113 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.1 Identities = 15/70 (21%), Positives = 30/70 (42%) Frame = +1 Query: 91 VRKQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS* 270 +++++ER+ K + + A+EK ++ R R A N ++T + Sbjct: 44 IQQEREREHERLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKL 103 Query: 271 QKRLGTSYQR 300 + GTS R Sbjct: 104 ESSDGTSLFR 113 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.1 Identities = 15/70 (21%), Positives = 30/70 (42%) Frame = +1 Query: 91 VRKQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS* 270 +++++ER+ K + + A+EK ++ R R A N ++T + Sbjct: 44 IQQEREREHERLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKL 103 Query: 271 QKRLGTSYQR 300 + GTS R Sbjct: 104 ESSDGTSLFR 113 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.1 Identities = 15/70 (21%), Positives = 30/70 (42%) Frame = +1 Query: 91 VRKQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS* 270 +++++ER+ K + + A+EK ++ R R A N ++T + Sbjct: 44 IQQEREREHERLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKL 103 Query: 271 QKRLGTSYQR 300 + GTS R Sbjct: 104 ESSDGTSLFR 113 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 5.1 Identities = 15/70 (21%), Positives = 30/70 (42%) Frame = +1 Query: 91 VRKQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS* 270 +++++ER+ K + + A+EK ++ R R A N ++T + Sbjct: 44 IQQEREREHERLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKL 103 Query: 271 QKRLGTSYQR 300 + GTS R Sbjct: 104 ESSDGTSLFR 113 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.2 bits (45), Expect = 5.1 Identities = 10/47 (21%), Positives = 25/47 (53%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARN 237 + +ER+Q +YK + + +KE++ + + ER + + + + N Sbjct: 279 RSREREQKSYKNENSYRKYRETSKERSRDKTERERSKERKIISSLSN 325 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 5.1 Identities = 15/70 (21%), Positives = 30/70 (42%) Frame = +1 Query: 91 VRKQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQNTKKS* 270 +++++ER+ K + + A+EK ++ R R A N ++T + Sbjct: 44 IQQEREREHERLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKL 103 Query: 271 QKRLGTSYQR 300 + GTS R Sbjct: 104 ESSDGTSLFR 113 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -3 Query: 494 CGMFIRREPLVWVLFLFFTFESLCFYRRNIQQFD 393 CG++ EP + F TF+ C +R + D Sbjct: 92 CGIYFLAEPDQKIEINFITFDIPCEHRGLVSIID 125 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 8.9 Identities = 11/53 (20%), Positives = 25/53 (47%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + +KE++ + ER + + + + N N Sbjct: 263 RSREREQKSYKNENSYRKYRETSKERSRDRTERERSREPKIISSLLNNTIHNN 315 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.9 Identities = 11/53 (20%), Positives = 25/53 (47%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + +KE++ + ER + + + + N N Sbjct: 274 RSREREQKSYKNENSYRKYRETSKERSRDRTERERSREPKIISSLLNNTIHNN 326 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.9 Identities = 11/53 (20%), Positives = 25/53 (47%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + +KE++ + ER + + + + N N Sbjct: 274 RSREREQKSYKNENSYRKYRETSKERSRDRTERERSREPKIISSLLNNTIHNN 326 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 8.9 Identities = 11/53 (20%), Positives = 25/53 (47%) Frame = +1 Query: 97 KQKERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 + +ER+Q +YK + + +KE++ + ER + + + + N N Sbjct: 263 RSREREQKSYKNENSYRKYRETSKERSRDRTERERSREPKIISSLLNNTIHNN 315 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.4 bits (43), Expect = 8.9 Identities = 11/51 (21%), Positives = 25/51 (49%) Frame = +1 Query: 103 KERKQFTYKMNTQKCEQNKEAKEKTFVEKQAERMQRLRNLHTARNEARTQN 255 +ER+Q +YK + + +KE++ + ER + + + + N+ N Sbjct: 276 REREQKSYKNENSYRKYRETSKERSRDRTERERSREPKIISSLSNKTIHNN 326 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.4 bits (43), Expect = 8.9 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Frame = +3 Query: 357 EEAETEGKNYD---RVKLLNISAIEAE 428 EEAE GK YD R L ++ E+E Sbjct: 533 EEAEKRGKEYDAAGRTYLFDLDYNESE 559 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,407 Number of Sequences: 438 Number of extensions: 4015 Number of successful extensions: 101 Number of sequences better than 10.0: 70 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -