SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e40h0138
         (721 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC4B3.17 |cbp3||ubiquinol cytochrome-c reductase assembly prot...    25   8.2  

>SPCC4B3.17 |cbp3||ubiquinol cytochrome-c reductase assembly protein
           Cbp3|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 283

 Score = 25.4 bits (53), Expect = 8.2
 Identities = 12/39 (30%), Positives = 22/39 (56%)
 Frame = +2

Query: 140 PLNRRHKLPKQQKRREPQK*HRHLEISP*FAPRLLLAPD 256
           P+N  +  P + KRR+P +  R+  ++P   PR +  P+
Sbjct: 36  PINVINHSPSETKRRDPVEELRYKPLTPPQDPRKVAPPN 74


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,435,841
Number of Sequences: 5004
Number of extensions: 41656
Number of successful extensions: 83
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 81
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 83
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 337208592
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -