BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0138 (721 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1555 - 27669981-27670148,27670232-27670315,27670349-276703... 31 0.92 >07_03_1555 - 27669981-27670148,27670232-27670315,27670349-27670360, 27670683-27670761,27670840-27671078,27671167-27671260, 27671342-27671484,27671688-27671786,27671870-27671998, 27672123-27672197,27672308-27672520,27672581-27672676, 27673282-27673380,27673600-27673839,27674212-27674322, 27674429-27674626,27674720-27674835,27675076-27675193, 27675761-27675866,27675972-27676030,27676259-27676388, 27676730-27676887,27677672-27677887,27677972-27678082, 27678313-27678472,27679364-27679509,27679603-27679695, 27680610-27680706,27681224-27681294,27681407-27681505, 27682037-27682168,27682287-27682729,27683252-27683564, 27684301-27684549 Length = 1631 Score = 31.1 bits (67), Expect = 0.92 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = -3 Query: 434 AISCQHTKLLRVGINASASVNVRVHFCIVFGNSACGVG*ANAESVC-HVSLYHLRNWRIN 258 A+ H L++ G+ SAS+ C AC +G A ++C +++L R WR++ Sbjct: 722 AVGAIHQHLIQNGLRMSASIVADTAQCFSTHQFACLIG-YGASAICPYLALETCRQWRLS 780 Query: 257 SQ 252 ++ Sbjct: 781 NK 782 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,636,419 Number of Sequences: 37544 Number of extensions: 265746 Number of successful extensions: 543 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 543 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1874582652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -