BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0137 (717 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17A5.08 |||COPII-coated vesicle component Erp2/3/4 |Schizosa... 25 8.2 SPAC1F12.04c |||conserved fungal protein|Schizosaccharomyces pom... 25 8.2 >SPAC17A5.08 |||COPII-coated vesicle component Erp2/3/4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 210 Score = 25.4 bits (53), Expect = 8.2 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -2 Query: 227 KTLQKSILFKAGNQGEYKYCYDQN 156 K Q + F +GEY++C+D + Sbjct: 77 KRRQADVFFTLEEKGEYEFCFDNH 100 >SPAC1F12.04c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 191 Score = 25.4 bits (53), Expect = 8.2 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -1 Query: 552 MFASFNFTLRPILLFIFQINFAKHI*PNF*I*NVLNVGYY 433 M F LR L+ +NF K P + N +N+GYY Sbjct: 44 MLNEFRCILRLPGLYKLIVNFRKDSSPETYMSNAINIGYY 83 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,677,629 Number of Sequences: 5004 Number of extensions: 51146 Number of successful extensions: 89 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -