BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0133 (696 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 26 1.3 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 26 1.3 AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 25 3.0 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 5.3 AY341201-1|AAR13765.1| 154|Anopheles gambiae NOS protein. 23 9.2 AY341200-1|AAR13764.1| 154|Anopheles gambiae NOS protein. 23 9.2 AY341199-1|AAR13763.1| 154|Anopheles gambiae NOS protein. 23 9.2 AY341198-1|AAR13762.1| 154|Anopheles gambiae NOS protein. 23 9.2 AY341197-1|AAR13761.1| 154|Anopheles gambiae NOS protein. 23 9.2 AY341196-1|AAR13760.1| 154|Anopheles gambiae NOS protein. 23 9.2 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 25.8 bits (54), Expect = 1.3 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +3 Query: 411 FRDYLHQLFFFELICFLFPYFKQNIILFCVIKKLQEQFKKNNP 539 F + ++Q+ + L+ L F +IL+C E F + NP Sbjct: 203 FEEEIYQIIYNVLVMCLMYTFPLIVILYCYGSIYYEIFSRTNP 245 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 25.8 bits (54), Expect = 1.3 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +3 Query: 411 FRDYLHQLFFFELICFLFPYFKQNIILFCVIKKLQEQFKKNNP 539 F + ++Q+ + L+ L F +IL+C E F + NP Sbjct: 203 FEEEIYQIIYNVLVMCLMYTFPLIVILYCYGSIYYEIFSRTNP 245 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 487 IIFCLK*GNKKQINSKKNNWCK*SRNNHNC 398 I+ CL G + QIN ++C+ R N C Sbjct: 9 IVSCLVSGLQAQINYCTTSYCRNGRQNVGC 38 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.8 bits (49), Expect = 5.3 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +3 Query: 426 HQLFFFELICFLFPYFKQNIILFCVIKKLQEQFKK 530 H LFF +I FL ++ N+IL V E KK Sbjct: 403 HMLFFI-VIIFLGSFYLVNLILAIVAMSYDELQKK 436 Score = 23.8 bits (49), Expect = 5.3 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -2 Query: 146 ISPIDLRHEINEQLAQIKGIISKFGGFVIPRERVMVVWNPSPSTTNET 3 ISP + I + + ++ + GFV +V+ + SPS T+ T Sbjct: 2089 ISPKESPDSIGDPQGRQTAVLVESDGFVTKNGHRVVIHSRSPSITSRT 2136 >AY341201-1|AAR13765.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 37 TTITRSRGITKPPNLEIIPLI*ASCS 114 T +TR IT PP +++ + + CS Sbjct: 52 TLLTRFMDITTPPTRQLLTYLASCCS 77 >AY341200-1|AAR13764.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 37 TTITRSRGITKPPNLEIIPLI*ASCS 114 T +TR IT PP +++ + + CS Sbjct: 52 TLLTRFMDITTPPTRQLLTYLASCCS 77 >AY341199-1|AAR13763.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 37 TTITRSRGITKPPNLEIIPLI*ASCS 114 T +TR IT PP +++ + + CS Sbjct: 52 TLLTRFMDITTPPTRQLLTYLASCCS 77 >AY341198-1|AAR13762.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 37 TTITRSRGITKPPNLEIIPLI*ASCS 114 T +TR IT PP +++ + + CS Sbjct: 52 TLLTRFMDITTPPTRQLLTYLASCCS 77 >AY341197-1|AAR13761.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 37 TTITRSRGITKPPNLEIIPLI*ASCS 114 T +TR IT PP +++ + + CS Sbjct: 52 TLLTRFMDITTPPTRQLLTYLASCCS 77 >AY341196-1|AAR13760.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 37 TTITRSRGITKPPNLEIIPLI*ASCS 114 T +TR IT PP +++ + + CS Sbjct: 52 TLLTRFMDITTPPTRQLLTYLASCCS 77 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 699,112 Number of Sequences: 2352 Number of extensions: 13750 Number of successful extensions: 31 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -