BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0132 (682 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_13921| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_9680| Best HMM Match : Ank (HMM E-Value=4e-20) 39 0.004 SB_25669| Best HMM Match : LRR_1 (HMM E-Value=9.1e-33) 39 0.004 SB_59316| Best HMM Match : LRR_1 (HMM E-Value=0) 38 0.010 SB_51944| Best HMM Match : LRR_1 (HMM E-Value=7.7e-34) 36 0.030 SB_48318| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.053 SB_13883| Best HMM Match : 7tm_1 (HMM E-Value=6e-08) 35 0.070 SB_5894| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.070 SB_15974| Best HMM Match : LRR_1 (HMM E-Value=7.1e-15) 34 0.12 SB_51703| Best HMM Match : LRR_1 (HMM E-Value=1.9e-06) 34 0.12 SB_53214| Best HMM Match : LRR_1 (HMM E-Value=7.4e-06) 33 0.16 SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) 33 0.21 SB_57674| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_47414| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_5006| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.86 SB_10598| Best HMM Match : LRR_1 (HMM E-Value=4.4e-19) 31 1.1 SB_7548| Best HMM Match : LRR_1 (HMM E-Value=8.7e-14) 31 1.1 SB_22355| Best HMM Match : Y_phosphatase (HMM E-Value=0) 30 1.5 SB_45576| Best HMM Match : LRR_1 (HMM E-Value=2.7e-14) 30 2.0 SB_41825| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_46837| Best HMM Match : LRR_1 (HMM E-Value=0.16) 29 3.5 SB_12190| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_39656| Best HMM Match : ATP_bind_3 (HMM E-Value=0.79) 29 4.6 SB_39376| Best HMM Match : Alpha-amylase_C (HMM E-Value=0.49) 29 4.6 SB_21415| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_41353| Best HMM Match : HLH (HMM E-Value=1.2) 29 4.6 SB_38193| Best HMM Match : DUF1279 (HMM E-Value=4.5) 28 6.1 SB_26267| Best HMM Match : TSP_C (HMM E-Value=0) 28 6.1 SB_47473| Best HMM Match : LRR_1 (HMM E-Value=2.8e-10) 28 6.1 SB_7052| Best HMM Match : LRR_1 (HMM E-Value=2e-12) 28 6.1 SB_52093| Best HMM Match : LRR_1 (HMM E-Value=1.3e-05) 28 8.0 SB_10896| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_10591| Best HMM Match : Spp-24 (HMM E-Value=6) 28 8.0 >SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1465 Score = 41.5 bits (93), Expect = 6e-04 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 4/92 (4%) Frame = +2 Query: 251 NRLDISYSQLPDFA----EHSFRELGLSITRLKLNFDNLSVLKESVFTKLDLVDYFSLAD 418 +R+DI L D + H R + ++ L L + +S + + F L + +L Sbjct: 42 HRVDIYCGYLADDSFSGLRHVPRNFPMQVSLLSLYNNLISTIHSNAFRNLTALRSLNLGA 101 Query: 419 NSLPELPRHVLQHLPHVKTLDLCRNKITKLPK 514 N L LPR V + L +++LDL N+++ LP+ Sbjct: 102 NRLSVLPRSVFRDLASLRSLDLSANRLSSLPE 133 Score = 35.5 bits (78), Expect = 0.040 Identities = 23/73 (31%), Positives = 37/73 (50%) Frame = +2 Query: 296 HSFRELGLSITRLKLNFDNLSVLKESVFTKLDLVDYFSLADNSLPELPRHVLQHLPHVKT 475 ++FR L ++ L L + LSVL SVF L + L+ N L LP + L ++ Sbjct: 86 NAFRNL-TALRSLNLGANRLSVLPRSVFRDLASLRSLDLSANRLSSLPEDTFEGLSSLQD 144 Query: 476 LDLCRNKITKLPK 514 L L N++ +P+ Sbjct: 145 LFLDFNRLRAIPE 157 Score = 29.5 bits (63), Expect = 2.6 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +2 Query: 257 LDISYSQLPDFAEHSFREL-GLSITRLKLNFDNLSVLKESVFTKLDLVDYFSLADNSLPE 433 L ++ + L +FR L GL I L LN +N++ L + +FT+ + ++ NSL Sbjct: 193 LQLNNNLLTRIEPGTFRNLRGLEI--LYLNNNNITELDQRLFTRTPSLKLLFVSFNSLAT 250 Query: 434 LPRHVLQHL 460 LPR + L Sbjct: 251 LPRGLFYSL 259 >SB_13921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 688 Score = 39.1 bits (87), Expect = 0.003 Identities = 23/68 (33%), Positives = 35/68 (51%) Frame = +2 Query: 317 LSITRLKLNFDNLSVLKESVFTKLDLVDYFSLADNSLPELPRHVLQHLPHVKTLDLCRNK 496 L T L LN NL + V L +++ L N L LP + + LP++K LDL N Sbjct: 17 LGTTTLDLNRKNLIEIPPKVLD-LQHLEFLYLEGNYLTTLPETLFERLPNLKWLDLRNNH 75 Query: 497 ITKLPKKI 520 I ++P+ + Sbjct: 76 INEVPENL 83 >SB_9680| Best HMM Match : Ank (HMM E-Value=4e-20) Length = 1243 Score = 38.7 bits (86), Expect = 0.004 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 3/68 (4%) Frame = +2 Query: 320 SITRLKLNFD--NLSVLKESVFTKLDL-VDYFSLADNSLPELPRHVLQHLPHVKTLDLCR 490 ++ R +N+ NL L ++ F L + LA+NSL ELP +L LP ++ LD+ Sbjct: 316 NVNRFSVNWGHKNLHALHKAWFVDYSLNLVRIDLANNSLHELPEELLNTLPLLEELDVSN 375 Query: 491 NKITKLPK 514 N + LP+ Sbjct: 376 NNLVSLPE 383 >SB_25669| Best HMM Match : LRR_1 (HMM E-Value=9.1e-33) Length = 1065 Score = 38.7 bits (86), Expect = 0.004 Identities = 23/86 (26%), Positives = 44/86 (51%) Frame = +2 Query: 245 N*NRLDISYSQLPDFAEHSFRELGLSITRLKLNFDNLSVLKESVFTKLDLVDYFSLADNS 424 N +L +S + + + +F L +S+ L ++F+ + E L L++ + +NS Sbjct: 192 NLRKLHVSATGMKKITQGTFGSL-MSLEFLDVSFNEIRHFDEESLACLPLLEVLHINNNS 250 Query: 425 LPELPRHVLQHLPHVKTLDLCRNKIT 502 L +P H L+ + +K LDL N I+ Sbjct: 251 LTTVPLHALRKVKFLKELDLSANLIS 276 Score = 31.5 bits (68), Expect = 0.65 Identities = 24/98 (24%), Positives = 48/98 (48%) Frame = +2 Query: 242 RN*NRLDISYSQLPDFAEHSFRELGLSITRLKLNFDNLSVLKESVFTKLDLVDYFSLADN 421 +N L +S S L SF++ + L L+ +++S +++ F L + +L +N Sbjct: 69 KNLGDLTVSRSPLKLLKNTSFQDYQY-LKWLDLSNNDISDIQDGTFENLRYLKQLNLGEN 127 Query: 422 SLPELPRHVLQHLPHVKTLDLCRNKITKLPKKISGIFK 535 + + + + L ++ LDL N + LP+ G+FK Sbjct: 128 KIRTVSASMFKGLVSLEKLDLRFNDLKALPR---GVFK 162 >SB_59316| Best HMM Match : LRR_1 (HMM E-Value=0) Length = 680 Score = 37.5 bits (83), Expect = 0.010 Identities = 28/86 (32%), Positives = 48/86 (55%) Frame = +2 Query: 257 LDISYSQLPDFAEHSFRELGLSITRLKLNFDNLSVLKESVFTKLDLVDYFSLADNSLPEL 436 LD+ +++ + SF L + L+L+ ++L+ L E+ LV+ L N L L Sbjct: 362 LDVGQNRI-EMLPDSFCNLS-KLWFLQLSKNHLTELPENFGNLTSLVE-LRLDSNQLSSL 418 Query: 437 PRHVLQHLPHVKTLDLCRNKITKLPK 514 P +L +VKTLDL RNK++++P+ Sbjct: 419 PAS-FANLTNVKTLDLYRNKLSEIPR 443 Score = 33.1 bits (72), Expect = 0.21 Identities = 24/63 (38%), Positives = 35/63 (55%) Frame = +2 Query: 320 SITRLKLNFDNLSVLKESVFTKLDLVDYFSLADNSLPELPRHVLQHLPHVKTLDLCRNKI 499 S+T L L + L+ L + VF +L + L +NSL ELP L L ++ L+L NK+ Sbjct: 64 SLTELYLTGNLLTSLPD-VFARLGNLTELHLNENSLEELPES-LGKLSKLRVLNLTGNKL 121 Query: 500 TKL 508 KL Sbjct: 122 EKL 124 >SB_51944| Best HMM Match : LRR_1 (HMM E-Value=7.7e-34) Length = 409 Score = 35.9 bits (79), Expect = 0.030 Identities = 21/52 (40%), Positives = 32/52 (61%) Frame = +2 Query: 380 TKLDLVDYFSLADNSLPELPRHVLQHLPHVKTLDLCRNKITKLPKKISGIFK 535 +KL ++ L+ NS+ ELP + + L ++K L L RNKI KLP I+ + K Sbjct: 170 SKLSSLEVLILSGNSIRELPDSI-KELVNLKELFLGRNKIRKLPPSITKLEK 220 Score = 33.1 bits (72), Expect = 0.21 Identities = 32/108 (29%), Positives = 56/108 (51%), Gaps = 4/108 (3%) Frame = +2 Query: 209 NRTSFNE*VQY-RN*NRLDISYSQLPDFAEHSFRELGLSITRLKLNFDNLSVLKESVFTK 385 N TS ++ ++ RN L+++ + + + + F L ++ L + +NL ++ ES+ K Sbjct: 253 NITSLSDEIRLLRNLVELNLNKNNIQELP-YDFHLLK-NLKTLFFSANNLEIVPESI-CK 309 Query: 386 LDLVDYFSLADNSLPELPRHVLQHLPHVKTL---DLCRNKITKLPKKI 520 L L + L+ N + LP V + + TL D+ NKIT LPK I Sbjct: 310 LPLRE-LDLSINKISSLPDFVRASIGDMSTLVELDISSNKITALPKSI 356 Score = 27.9 bits (59), Expect = 8.0 Identities = 25/86 (29%), Positives = 39/86 (45%) Frame = +2 Query: 320 SITRLKLNFDNLSVLKESVFTKLDLVDYFSLADNSLPELPRHVLQHLPHVKTLDLCRNKI 499 ++ L LN +N+ L +L F A+N L +P + + LP ++ LDL NKI Sbjct: 266 NLVELNLNKNNIQELPYDFHLLKNLKTLFFSANN-LEIVPESICK-LP-LRELDLSINKI 322 Query: 500 TKLPKKISGIFKNWSICWSLTIKYQK 577 + LP + + S L I K Sbjct: 323 SSLPDFVRASIGDMSTLVELDISSNK 348 >SB_48318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1243 Score = 35.1 bits (77), Expect = 0.053 Identities = 22/63 (34%), Positives = 35/63 (55%) Frame = +2 Query: 332 LKLNFDNLSVLKESVFTKLDLVDYFSLADNSLPELPRHVLQHLPHVKTLDLCRNKITKLP 511 L L + L ++ E V TKL+ + L+DN + LP L L +++ L L N++ LP Sbjct: 172 LNLEANELKIVPE-VVTKLEKLQVLILSDNEIGALPAD-LNALENLRELYLDDNRLMSLP 229 Query: 512 KKI 520 KK+ Sbjct: 230 KKL 232 >SB_13883| Best HMM Match : 7tm_1 (HMM E-Value=6e-08) Length = 535 Score = 34.7 bits (76), Expect = 0.070 Identities = 21/61 (34%), Positives = 30/61 (49%) Frame = +2 Query: 323 ITRLKLNFDNLSVLKESVFTKLDLVDYFSLADNSLPELPRHVLQHLPHVKTLDLCRNKIT 502 I L L+ + L ++ E VF V +LADN L E+ L L + L+L NK+ Sbjct: 28 IHSLDLSSNQLKIIPEFVFRGFSNVKNLTLADNDLEEIGNASLSGLKSLLYLNLANNKLR 87 Query: 503 K 505 K Sbjct: 88 K 88 >SB_5894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 379 Score = 34.7 bits (76), Expect = 0.070 Identities = 18/56 (32%), Positives = 31/56 (55%) Frame = +2 Query: 344 FDNLSVLKESVFTKLDLVDYFSLADNSLPELPRHVLQHLPHVKTLDLCRNKITKLP 511 ++ LS L +S+ +D F++ N++ ELP +L L ++ +L L RNK P Sbjct: 2 YNQLSSLPDSL-ANCSGIDEFNIEGNNIAELPEKLLSSLKNLTSLTLSRNKFEVFP 56 >SB_15974| Best HMM Match : LRR_1 (HMM E-Value=7.1e-15) Length = 272 Score = 33.9 bits (74), Expect = 0.12 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 2/76 (2%) Frame = +2 Query: 308 ELGLSITRLKLNFDNLSVLKESVFTKLDLVD--YFSLADNSLPELPRHVLQHLPHVKTLD 481 + G++ T L LN ++L LK K DL D L++N L LP L L ++ LD Sbjct: 37 DCGITETVL-LNDNDLPNLKGGGQLK-DLADARILVLSNNRLTSLPAD-LDELRSLQVLD 93 Query: 482 LCRNKITKLPKKISGI 529 + NK+ LPK I G+ Sbjct: 94 VANNKLKSLPKAIGGL 109 >SB_51703| Best HMM Match : LRR_1 (HMM E-Value=1.9e-06) Length = 632 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/51 (29%), Positives = 29/51 (56%) Frame = +1 Query: 511 EEDFRDIQELEHLLVADNQISEIEKDALPKGLKHVHLGINKLNTLNGALRD 663 +E + + L+ L ++ N IS ++ LPK LK + L NK++ ++ R+ Sbjct: 128 DEGLLNFKNLQQLTLSANLISLVDSQRLPKCLKELELSANKISDISSLCRN 178 >SB_53214| Best HMM Match : LRR_1 (HMM E-Value=7.4e-06) Length = 298 Score = 33.5 bits (73), Expect = 0.16 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 3/54 (5%) Frame = +1 Query: 520 FRDIQELEHLLVADNQISEIEKDA---LPKGLKHVHLGINKLNTLNGALRDLDD 672 F D++ L+H V DNQI ++ D + G K + +G NK+N + A++ + D Sbjct: 165 FLDLKSLKHFFVGDNQIKKVADDVFQNVSNGFK-LDIGRNKMNGVPDAVKRVMD 217 Score = 32.3 bits (70), Expect = 0.37 Identities = 20/82 (24%), Positives = 39/82 (47%) Frame = +2 Query: 323 ITRLKLNFDNLSVLKESVFTKLDLVDYFSLADNSLPELPRHVLQHLPHVKTLDLCRNKIT 502 +T L L+ + L + F L + +F + DN + ++ V Q++ + LD+ RNK+ Sbjct: 147 LTILYLSNNFLDSIPGGCFLDLKSLKHFFVGDNQIKKVADDVFQNVSNGFKLDIGRNKMN 206 Query: 503 KLPKKISGIFKNWSICWSLTIK 568 +P + + S L+ K Sbjct: 207 GVPDAVKRVMDRLSYLIQLSRK 228 >SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) Length = 791 Score = 33.1 bits (72), Expect = 0.21 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +2 Query: 395 VDYFSLADNSLPELPRHVLQHLPHVKTLDLCRNKITKLP 511 +D F++ N++ ELP +L L ++ +L L RNK P Sbjct: 287 IDEFNIEGNNIAELPEKLLSSLKNLTSLTLSRNKFEVFP 325 >SB_57674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 424 Score = 33.1 bits (72), Expect = 0.21 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +2 Query: 386 LDLVDYFSLADNSLPELPRHVLQHLPHVKTLDLCRNKITKL 508 L +D SL L ++ +LQ L ++ LDL NK+ KL Sbjct: 24 LSAIDTLSLQGQGLSQIESEILQQLTAIEELDLSNNKLVKL 64 >SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2229 Score = 32.3 bits (70), Expect = 0.37 Identities = 21/67 (31%), Positives = 34/67 (50%) Frame = +2 Query: 323 ITRLKLNFDNLSVLKESVFTKLDLVDYFSLADNSLPELPRHVLQHLPHVKTLDLCRNKIT 502 + RL L + L + + K+ + Y L+DN L +LPR + P +KTL L N + Sbjct: 396 LCRLDLQKNKLRKIPSGLL-KMTCLKYLDLSDNELTDLPRK--EWSPVLKTLYLSGNLLE 452 Query: 503 KLPKKIS 523 LP ++ Sbjct: 453 TLPDSMA 459 >SB_47414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 520 Score = 31.9 bits (69), Expect = 0.49 Identities = 21/72 (29%), Positives = 37/72 (51%) Frame = +2 Query: 320 SITRLKLNFDNLSVLKESVFTKLDLVDYFSLADNSLPELPRHVLQHLPHVKTLDLCRNKI 499 ++ RL ++ + L L E +F L+L+ A+N + L V L +K LDL NK+ Sbjct: 133 NLARLDISHNRLESLPEGIFN-LELIAEIYAANNLIQALGNEV-GCLHVLKVLDLSENKL 190 Query: 500 TKLPKKISGIFK 535 +P +++ K Sbjct: 191 EAIPCELADCLK 202 >SB_5006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 657 Score = 31.1 bits (67), Expect = 0.86 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +1 Query: 535 ELEHLLVADNQISEIEKDALPKGLKHVHLGINKLNTLNGALRDL 666 + E L+VA N+I+ + H G NKL L+GA +D+ Sbjct: 532 KFEELVVASNEITASTAQLVAASRVKAHRGSNKLQALHGASKDV 575 >SB_10598| Best HMM Match : LRR_1 (HMM E-Value=4.4e-19) Length = 811 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/61 (22%), Positives = 36/61 (59%) Frame = +2 Query: 347 DNLSVLKESVFTKLDLVDYFSLADNSLPELPRHVLQHLPHVKTLDLCRNKITKLPKKISG 526 +N + S +L ++ L +N++ LP + + LP+++ +++ NK+T+LP+ ++ Sbjct: 155 NNCLICLSSRIIELQSLEKLLLMENNITVLPAEIAK-LPNLQFVNVFDNKLTRLPESLTD 213 Query: 527 I 529 + Sbjct: 214 L 214 >SB_7548| Best HMM Match : LRR_1 (HMM E-Value=8.7e-14) Length = 384 Score = 30.7 bits (66), Expect = 1.1 Identities = 21/62 (33%), Positives = 29/62 (46%) Frame = +2 Query: 347 DNLSVLKESVFTKLDLVDYFSLADNSLPELPRHVLQHLPHVKTLDLCRNKITKLPKKISG 526 D LSV S + KL+ A N + +P +LPH+ LDL N+I LP Sbjct: 52 DLLSVYSVSFYEKLNF------AFNCITAVPYEFSMYLPHLVHLDLSYNRIGFLPDSFGY 105 Query: 527 IF 532 +F Sbjct: 106 LF 107 Score = 29.9 bits (64), Expect = 2.0 Identities = 19/66 (28%), Positives = 35/66 (53%) Frame = +2 Query: 323 ITRLKLNFDNLSVLKESVFTKLDLVDYFSLADNSLPELPRHVLQHLPHVKTLDLCRNKIT 502 + L L+++ + L +S F L ++ + +N L ELP +L ++ LDL N++ Sbjct: 86 LVHLDLSYNRIGFLPDS-FGYLFHLETLFINNNKLRELP-DTFCYLARLQKLDLSHNQLL 143 Query: 503 KLPKKI 520 LP+ I Sbjct: 144 HLPENI 149 >SB_22355| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 1252 Score = 30.3 bits (65), Expect = 1.5 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +2 Query: 509 PKKISGIFKNWSICWSL 559 PKK +GI K++ +CWSL Sbjct: 118 PKKTNGILKSFKVCWSL 134 >SB_45576| Best HMM Match : LRR_1 (HMM E-Value=2.7e-14) Length = 829 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = +2 Query: 407 SLADNSLPELPRHVLQHLPHVKTLDLCRNKITKLPKKISGIFK 535 SL + +L +P V+ HL ++ LDL NK+T +P I+ + K Sbjct: 528 SLENCNLTSIP-DVVFHLESLEKLDLNNNKLTSIPAGITNLTK 569 >SB_41825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 825 Score = 29.1 bits (62), Expect = 3.5 Identities = 21/81 (25%), Positives = 38/81 (46%) Frame = +2 Query: 257 LDISYSQLPDFAEHSFRELGLSITRLKLNFDNLSVLKESVFTKLDLVDYFSLADNSLPEL 436 LD+S + +F L S+ LKL+ + +S ++ F + + +L N L + Sbjct: 90 LDLSRNFFTSILASAFNRLS-SLEVLKLSKNRISTIR-GAFWGQNKLQQLNLERNRLSHI 147 Query: 437 PRHVLQHLPHVKTLDLCRNKI 499 +HL +K L+L N+I Sbjct: 148 QDTTFKHLLALKVLNLANNRI 168 >SB_46837| Best HMM Match : LRR_1 (HMM E-Value=0.16) Length = 197 Score = 29.1 bits (62), Expect = 3.5 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 532 QELEHLLVADNQISEIEKDALPKGLKHV 615 + L HL ++DN ++ +E + LPK LK + Sbjct: 132 RNLTHLDLSDNLLTSLEDNTLPKSLKEI 159 >SB_12190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 740 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/49 (30%), Positives = 29/49 (59%) Frame = +2 Query: 335 KLNFDNLSVLKESVFTKLDLVDYFSLADNSLPELPRHVLQHLPHVKTLD 481 +L DN++VLKE + T L L + F + + + ++ ++ Q + VK +D Sbjct: 162 QLGLDNINVLKEQLTTNLSLANCFGILSDEVCDV-SNIEQLVTFVKYVD 209 >SB_39656| Best HMM Match : ATP_bind_3 (HMM E-Value=0.79) Length = 492 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -3 Query: 176 QDSAGAGVLTSAGARGDFSSHGAMQASSSTELPCKSTQQRG 54 +D + G+ T +G+ S++ ++S EL C+S +RG Sbjct: 114 KDGSVNGIATRTVDKGNISTNEIFTGNNSNELDCQSCNERG 154 >SB_39376| Best HMM Match : Alpha-amylase_C (HMM E-Value=0.49) Length = 679 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -3 Query: 176 QDSAGAGVLTSAGARGDFSSHGAMQASSSTELPCKSTQQRG 54 +D + G+ T +G+ S++ ++S EL C+S +RG Sbjct: 459 KDGSVNGIATRTVDKGNISTNEIFTGNNSNELDCQSCNERG 499 >SB_21415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 28.7 bits (61), Expect = 4.6 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Frame = +1 Query: 514 EDFRDIQELEHLLVADNQISEIEKDALPKGLKHVHLGINKLNTLNGA--LRDLDDLE 678 E + +Q L HL ++ NQIS IE L+ ++L N++ + G LR L L+ Sbjct: 50 EGLQHLQNLRHLDLSSNQISHIEGLTSLGYLRVLNLSCNRIYLVEGLENLRKLTKLD 106 >SB_41353| Best HMM Match : HLH (HMM E-Value=1.2) Length = 500 Score = 28.7 bits (61), Expect = 4.6 Identities = 18/81 (22%), Positives = 37/81 (45%), Gaps = 1/81 (1%) Frame = +1 Query: 418 QLFAGVTKACASAPASRKDTRSL*EQDN*APEE-DFRDIQELEHLLVADNQISEIEKDAL 594 +L+ V+ +++P + + + QD D + E LVA++ + + Sbjct: 173 ELYDDVSSRVSASPRGKDNDKKYARQDTAVQLSIDIETLSEQLVSLVAEHILDREDVTGW 232 Query: 595 PKGLKHVHLGINKLNTLNGAL 657 + LK HL +NK + +N +L Sbjct: 233 KEALKETHLALNKQSEINTSL 253 >SB_38193| Best HMM Match : DUF1279 (HMM E-Value=4.5) Length = 351 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -3 Query: 155 VLTSAGARGDFSSHGAMQASSSTELPCKSTQQRGGERVLRRDHRVCR 15 V +AG F A S + + S ++ E+V+RR HR CR Sbjct: 173 VFKAAGEAMKFLGENAWLLISRSRVLGSSNAKQSSEQVIRRGHRECR 219 >SB_26267| Best HMM Match : TSP_C (HMM E-Value=0) Length = 2996 Score = 28.3 bits (60), Expect = 6.1 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = +2 Query: 368 ESVFTKLDLVDYFSLADNSLPELPRHVLQHLPHVKTLDLCRNKITKL 508 E F + + +L++N++ + L H+K LDL NK++ + Sbjct: 154 EPFFQNRSQLVHLNLSNNAIESIASEAFSQLIHLKVLDLRHNKLSTI 200 >SB_47473| Best HMM Match : LRR_1 (HMM E-Value=2.8e-10) Length = 658 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/59 (23%), Positives = 29/59 (49%) Frame = +2 Query: 320 SITRLKLNFDNLSVLKESVFTKLDLVDYFSLADNSLPELPRHVLQHLPHVKTLDLCRNK 496 ++ L L F+N+ ++ F L+ ++Y +++DN + L + LD+ NK Sbjct: 93 ALRNLSLTFNNIHTIRARGFAGLNKLEYLNMSDNRISTWEIDRDTELRSLVVLDISGNK 151 >SB_7052| Best HMM Match : LRR_1 (HMM E-Value=2e-12) Length = 1328 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/68 (25%), Positives = 33/68 (48%) Frame = +2 Query: 320 SITRLKLNFDNLSVLKESVFTKLDLVDYFSLADNSLPELPRHVLQHLPHVKTLDLCRNKI 499 ++ RL L+ + L + + +++ +L+ N P + L +K+LDL NK+ Sbjct: 974 NVERLDLSGNFLQDFPPLLHEAMPKLEHMNLSHNEFETFP-YCLVKCKRLKSLDLSYNKL 1032 Query: 500 TKLPKKIS 523 T P +S Sbjct: 1033 TNSPPPLS 1040 >SB_52093| Best HMM Match : LRR_1 (HMM E-Value=1.3e-05) Length = 252 Score = 27.9 bits (59), Expect = 8.0 Identities = 25/87 (28%), Positives = 39/87 (44%), Gaps = 5/87 (5%) Frame = +2 Query: 260 DISYSQLPDFAEHSFRELGL---SITRLK-LNFDNLSVLKESVFTKLDLVDYFSLADNSL 427 D+ LP LG S TRLK L+ ++ L L++ +L N++ Sbjct: 23 DVKSLSLPGTYHEKITSLGTALKSFTRLKNLDLSRNAIQSLQGVESLQLLETLNLYYNNI 82 Query: 428 PELPR-HVLQHLPHVKTLDLCRNKITK 505 L L++L ++K LDL N +TK Sbjct: 83 SYLQDLSALKYLTNLKELDLRLNPVTK 109 >SB_10896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +2 Query: 458 LPHVKTLDLCRNKITKLPKKISG--IFKNW 541 L KT+DLC N TK PK S I K W Sbjct: 222 LAKAKTIDLCNNPQTKEPKLQSAVRIVKEW 251 >SB_10591| Best HMM Match : Spp-24 (HMM E-Value=6) Length = 225 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = +2 Query: 449 LQHLPHVKTLDLCRNKITK-LPKKISGIFKNWSICWSLTIKYQK*KKTRCL 598 L+ P V LC + + + +K G++ S+CW + K K K R L Sbjct: 61 LKRHPSVGVCSLCSSVLESVMSQKYLGVYITSSLCWGMQAKEVKKKGNRVL 111 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,839,471 Number of Sequences: 59808 Number of extensions: 436147 Number of successful extensions: 1175 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 1063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1172 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -