BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0130 (705 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2G5.07c |rpc25||DNA-directed RNA polymerase III complex subu... 28 1.1 SPCC1235.10c |sec6||exocyst complex subunit Sec6|Schizosaccharom... 26 6.0 >SPBC2G5.07c |rpc25||DNA-directed RNA polymerase III complex subunit Rpc25|Schizosaccharomyces pombe|chr 2|||Manual Length = 203 Score = 28.3 bits (60), Expect = 1.1 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = -1 Query: 180 SDIT*IHNSETFKLVKFTDQERANNFFFNEILNDVGQADCIF 55 SDI IH S +K K E + + N+++ ++G A C++ Sbjct: 8 SDIISIHPSNFWKPTKEALAEEIHKKYANKVIQNIGLAICVY 49 >SPCC1235.10c |sec6||exocyst complex subunit Sec6|Schizosaccharomyces pombe|chr 3|||Manual Length = 730 Score = 25.8 bits (54), Expect = 6.0 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -2 Query: 164 YTTVKLSSL*NSLIKNEQIIFFLMKF*MMLDKQIVFFLGFRYRLS-LTELKHE 9 Y T ++ S N+L+K +I +++ + LD + L Y+LS L E + E Sbjct: 86 YATKQMISQLNNLVKETDVIEDMLREDLELDSDMPNLLRAHYKLSKLREFREE 138 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,620,881 Number of Sequences: 5004 Number of extensions: 49394 Number of successful extensions: 116 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 116 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -