BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0130 (705 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0628 - 5460030-5462960 30 2.1 06_03_1274 + 28897491-28897707,28897804-28897935,28898029-288980... 29 2.7 >08_01_0628 - 5460030-5462960 Length = 976 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +3 Query: 381 RRTAYEQAPGEFKHIELLSALQTPTWQMIRELPESPSKSK 500 R T E+ P + ++ L L T W M+++LP S SK K Sbjct: 647 RSTFIEELPKDLGKLQKLQTLDTK-WSMVQKLPSSLSKLK 685 >06_03_1274 + 28897491-28897707,28897804-28897935,28898029-28898096, 28898216-28898280,28898468-28898534,28898630-28898917, 28898995-28899102,28899236-28899487,28899918-28899997, 28900092-28900185,28900728-28900810,28901319-28901873, 28902085-28902616 Length = 846 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = -3 Query: 445 CRADNNSICLNSPGACSYAVLRVLRSEQNYTHITVLSLTENFGFNNASGTF 293 C A +NS ++P AC + ++ + N + +LSL + + N G + Sbjct: 492 CDASSNSAKSSTPDACFFFADNLVVVDHNNGDVYILSLHDEYSSGNGDGDY 542 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,855,588 Number of Sequences: 37544 Number of extensions: 283791 Number of successful extensions: 632 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 632 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -