BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0130 (705 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g02410.1 68415.m00181 expressed protein 29 2.3 At1g66150.1 68414.m07508 leucine-rich repeat protein kinase, put... 27 9.2 >At2g02410.1 68415.m00181 expressed protein Length = 308 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 180 YYKMPPKIDQGLIIILDNGRNVANAMKKTKKAFMRWRVNV 299 YY +D + ++L +G NV K KK FM+ R++V Sbjct: 119 YYTNQGLLDDAVPVLLVDGYNVCGYWMKLKKHFMKGRLDV 158 >At1g66150.1 68414.m07508 leucine-rich repeat protein kinase, putative (TMK1) identical to protein kinase TMK1 gi|166888|gb|AAA32876, SP|P43298 Putative receptor protein kinase TMK1 precursor (EC 2.7.1.-) {Arabidopsis thaliana} Length = 942 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 436 DNNSICLNSPGACSYAVLRVL 374 D+NS CL+SPG C V +L Sbjct: 309 DSNSFCLSSPGECDPRVKSLL 329 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,274,690 Number of Sequences: 28952 Number of extensions: 246378 Number of successful extensions: 558 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 558 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -