BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0129 (646 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 40 2e-05 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 25 0.83 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 3.3 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 3.3 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 40.3 bits (90), Expect = 2e-05 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +1 Query: 106 VLDRRIKNGVLEYYLKWKGYSDEDNTWEPEDNL-DCPDLIQAF 231 +L ++ GV Y +KWK + + NTWEP NL +C D+++ F Sbjct: 249 ILAKKEIKGVPTYLIKWKNWDLKYNTWEPISNLINCSDILEEF 291 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 24.6 bits (51), Expect = 0.83 Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -1 Query: 508 CGHRTLACFAG-TRSASSVPCHFMRNMSSPLLS 413 C T+ CF G R + C ++ + P+LS Sbjct: 292 CSGHTVRCFTGGPRKSHESQCPMLQKLEKPVLS 324 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.6 bits (46), Expect = 3.3 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -3 Query: 482 CWYKICFICSLP 447 CW+KIC+ + P Sbjct: 489 CWWKICWTITTP 500 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.6 bits (46), Expect = 3.3 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -3 Query: 482 CWYKICFICSLP 447 CW+KIC+ + P Sbjct: 542 CWWKICWTITTP 553 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,315 Number of Sequences: 438 Number of extensions: 2672 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19438227 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -