BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0129 (646 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g17690.1 68418.m02073 like heterochromatin protein (LHP1) ide... 45 4e-05 At4g19020.1 68417.m02803 chromomethylase 2 (CMT2) nearly identic... 38 0.006 At2g47450.1 68415.m05922 chloroplast signal recognition particle... 33 0.16 At1g80740.1 68414.m09473 chromomethylase 1 (CMT1) identical to c... 31 0.50 At1g69770.1 68414.m08028 chromomethylase 3 (CMT3) nearly identic... 29 2.6 At4g01870.1 68417.m00245 tolB protein-related contains weak simi... 28 4.6 At2g13370.1 68415.m01476 chromodomain-helicase-DNA-binding famil... 28 4.6 At3g56930.1 68416.m06332 zinc finger (DHHC type) family protein ... 28 6.1 At2g25170.1 68415.m03010 chromatin remodeling factor CHD3 (PICKL... 27 8.1 >At5g17690.1 68418.m02073 like heterochromatin protein (LHP1) identical to like heterochromatin protein LHP1 [Arabidopsis thaliana] GI:15625407; contains Pfam profile PF00385: 'chromo' (CHRromatin Organization MOdifier) Length = 445 Score = 45.2 bits (102), Expect = 4e-05 Identities = 17/40 (42%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = +1 Query: 115 RRIKNGVLEYYLKWKGYSDEDNTWEPEDNL-DCPDLIQAF 231 +R++ G ++Y +KW+G+ + NTWEP +NL D+I AF Sbjct: 116 KRVRKGKVQYLIKWRGWPETANTWEPLENLQSIADVIDAF 155 >At4g19020.1 68417.m02803 chromomethylase 2 (CMT2) nearly identical to chromomethylase CMT2 [Arabidopsis thaliana] GI:14583094 Length = 1295 Score = 37.9 bits (84), Expect = 0.006 Identities = 17/41 (41%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Frame = +1 Query: 112 DRRIKNGVLEYYLKWKGYSDEDNTWEPEDNL-DCPDLIQAF 231 D+ KNG L++ + WKGY +++TWE + L +C D I+ F Sbjct: 851 DKTGKNG-LKFKVHWKGYRSDEDTWELAEELSNCQDAIREF 890 >At2g47450.1 68415.m05922 chloroplast signal recognition particle component (CAO) nearly identical to CAO [Arabidopsis thaliana] GI:4102582 Length = 373 Score = 33.1 bits (72), Expect = 0.16 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 136 LEYYLKWKGYSDEDNTWEPEDNLD 207 +EY +KW SD TWEP+DN+D Sbjct: 337 IEYLVKWTDMSDA--TWEPQDNVD 358 >At1g80740.1 68414.m09473 chromomethylase 1 (CMT1) identical to chromomethylase GB:AAC02660 GI:2865416 from [Arabidopsis thaliana] Length = 791 Score = 31.5 bits (68), Expect = 0.50 Identities = 11/33 (33%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +1 Query: 136 LEYYLKWKGYSDEDNTWEPEDNL-DCPDLIQAF 231 L+ ++WKGY+ +TWEP L +C + ++ + Sbjct: 360 LQLMVRWKGYNSSYDTWEPYSGLGNCKEKLKEY 392 >At1g69770.1 68414.m08028 chromomethylase 3 (CMT3) nearly identical to chromomethylase CMT3 [Arabidopsis thaliana] GI:14583092, GI:14647157 Length = 839 Score = 29.1 bits (62), Expect = 2.6 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 121 IKNGVLEYYLKWKGYSDEDNTWEPEDNL-DCPDLIQAF 231 +K G L ++W Y D +TWEP + L +C I+ F Sbjct: 399 LKRG-LYLKVRWLNYDDSHDTWEPIEGLSNCRGKIEEF 435 >At4g01870.1 68417.m00245 tolB protein-related contains weak similarity to TolB protein precursor (Swiss-Prot:P44677) [Haemophilus influenzae] Length = 652 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 148 LKWKGYSDEDNTWEPEDNLDCPDL 219 L W GY D TW D LD L Sbjct: 605 LTWNGYEDGTPTWHTADELDLSQL 628 >At2g13370.1 68415.m01476 chromodomain-helicase-DNA-binding family protein / CHD family protein similar to SP|O14647 Chromodomain-helicase-DNA-binding protein 2 (CHD-2) {Homo sapiens}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00385: 'chromo' (CHRromatin Organization MOdifier) Length = 1722 Score = 28.3 bits (60), Expect = 4.6 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 4/34 (11%) Frame = +1 Query: 106 VLDRRIKNG----VLEYYLKWKGYSDEDNTWEPE 195 + DR K+G V EY +KW+G S + TWE + Sbjct: 539 IADRISKDGLGDVVPEYLVKWQGLSYAEATWEKD 572 >At3g56930.1 68416.m06332 zinc finger (DHHC type) family protein low similarity to Golgi-specific DHHC zinc figer protein [Mus musculus] GI:21728103; contains Pfam profile PF01529: DHHC zinc finger domain Length = 477 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 416 IRSANYFFWF*STIKTRCFLVITFGFLCTFE 324 +R+ +FF F ST T C V F +L F+ Sbjct: 185 VRNYRFFFMFISTSTTLCIYVFAFSWLNIFQ 215 >At2g25170.1 68415.m03010 chromatin remodeling factor CHD3 (PICKLE) identical to chromatin remodeling factor CHD3 [Arabidopsis thaliana] GI:6478518 Length = 1384 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 106 VLDRRIKNGVLEYYLKWKGYSDEDNTWEPEDNL 204 +L R ++G LEY +K+K S ++ WE E ++ Sbjct: 195 ILACREEDGELEYLVKYKELSYDECYWESESDI 227 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,895,861 Number of Sequences: 28952 Number of extensions: 222632 Number of successful extensions: 527 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 527 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1334473344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -