BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0126 (447 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 22 3.5 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 21 4.6 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 21 8.1 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 21.8 bits (44), Expect = 3.5 Identities = 7/13 (53%), Positives = 9/13 (69%), Gaps = 1/13 (7%) Frame = +1 Query: 259 NRISWNSCNN-WN 294 + + W SCNN WN Sbjct: 94 SELPWGSCNNYWN 106 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 21.4 bits (43), Expect = 4.6 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 183 ILQAYEYIEASFTIADRIYGST 248 +LQA EYIE A+ Y ST Sbjct: 6 LLQAAEYIERREREAEHGYAST 27 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 20.6 bits (41), Expect = 8.1 Identities = 8/37 (21%), Positives = 21/37 (56%) Frame = +1 Query: 208 KLLLQLLIEFMDPLFSSNRISWNSCNNWNFISINLLY 318 K+ + LLI + +FS +++ C+ + +++ +Y Sbjct: 18 KVKIVLLIFYGSIMFSMTQVNKEECDYYQNLNLGEIY 54 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,970 Number of Sequences: 438 Number of extensions: 1742 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11697255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -