BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0124 (688 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 23 9.0 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 9.0 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 23.0 bits (47), Expect = 9.0 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -2 Query: 636 QRILLIPPRTPAPEPHGSDSKLSIFNALPKTVYHFI 529 QR++L+P P +GS L + +AL K + I Sbjct: 539 QRLVLLPKPGKPPGSNGSYRPLCMLDALGKVLEKLI 574 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.0 bits (47), Expect = 9.0 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = -2 Query: 654 PPSKLPQRILLIPPRTPAPEPHGSDSKLSIFNALPKTVYHFI 529 PP QR++L+P P S L + +AL K + I Sbjct: 541 PPQWKRQRLVLLPKPGKPPGESSSYRPLCMLDALGKVLERLI 582 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 733,030 Number of Sequences: 2352 Number of extensions: 15108 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -