BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0123 (661 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPACUNK4.17 |||NAD binding dehydrogenase family protein|Schizosa... 28 1.4 SPBC2D10.20 |ubc1||ubiquitin conjugating enzyme Ubc1|Schizosacch... 25 7.3 >SPACUNK4.17 |||NAD binding dehydrogenase family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 405 Score = 27.9 bits (59), Expect = 1.4 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -1 Query: 277 LRSFDSI*RKILVIPNDSAY*LSFRIFLEIVHF*CEKTIWH 155 +RS DS K+ PND Y F+IFL+ +K + H Sbjct: 345 VRSPDSDEEKVYKYPNDDPYYSEFKIFLDAAEGKGDKNLIH 385 >SPBC2D10.20 |ubc1||ubiquitin conjugating enzyme Ubc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 217 Score = 25.4 bits (53), Expect = 7.3 Identities = 15/52 (28%), Positives = 23/52 (44%) Frame = +2 Query: 152 RMPNRLFALKVYNFQKYSKTELICGIVWYHQYFSLNTVKRAQFCFIFVFCLP 307 R P F K+Y+ S+T IC + Q+ + T+K A + C P Sbjct: 66 RPPKMNFDTKIYHPNVSSQTGAICLDILKDQWSPVYTMKSALISLQSLLCTP 117 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,514,683 Number of Sequences: 5004 Number of extensions: 48371 Number of successful extensions: 117 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -