BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0120 (442 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 4.5 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 6.0 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 7.9 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.4 bits (43), Expect = 4.5 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 347 IRNASWELIGVDG 385 I N W+L+GV G Sbjct: 192 ITNGEWDLLGVPG 204 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.0 bits (42), Expect = 6.0 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +2 Query: 287 ISDTIITNPGDEFLCVGDFNIRNASWELIGVDGPARLLN 403 IS T+ + LC + I ++ IG P+ +LN Sbjct: 1415 ISSTVQKYTLENLLCGSRYQIYVTAYNGIGTGDPSDMLN 1453 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 20.6 bits (41), Expect = 7.9 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +3 Query: 39 YRCDRNYNSRNDSLGGGVLIAVRRGITVFNLTCLPSN 149 Y CD + ++ D LG V+ G+ CL +N Sbjct: 130 YDCDVDVSTFFDQLGQEVIYTACVGLLERAFRCLGNN 166 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,125 Number of Sequences: 438 Number of extensions: 2319 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11450997 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -