BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0118 (709 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 25 0.60 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 25 0.60 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 25 0.80 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 3.2 AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 21 7.4 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 21 9.8 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 25.0 bits (52), Expect = 0.60 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = +3 Query: 519 ISHDNYCTICKLIMNCRNNYKFH 587 +S N C IC +++C++ + H Sbjct: 131 LSDPNQCVICHRVLSCKSALQMH 153 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 25.0 bits (52), Expect = 0.60 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +2 Query: 584 SQYRNSITCENPALYGGYPCYTRD*NRVI*NCVIRLPCYKG 706 +QY +S TC P + G C T D + +C+ C G Sbjct: 1 NQYVDSYTCTCPLGFSGINCQTNDEDCTETSCMNGGTCIDG 41 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 24.6 bits (51), Expect = 0.80 Identities = 18/57 (31%), Positives = 24/57 (42%), Gaps = 7/57 (12%) Frame = -2 Query: 597 FLYCEIYNYFYNS*LICILY-------SNCHVKLK*IIYYICVPSFVIGKTLVILYY 448 FL C Y Y+ L+C+ Y H+ IYY VP F L+ +YY Sbjct: 96 FLLCTYYFYYAFIILLCVYYFYYAFIIFTVHLLFLLCIYYFVVPLFF----LLCIYY 148 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 Query: 555 LICILYSNCHVKLK*IIYYICVPSFVIGKT 466 L+CI Y C + + IYY C +F+I T Sbjct: 282 LLCIYYFYCALIILLCIYYFC-RAFIIFPT 310 Score = 22.6 bits (46), Expect = 3.2 Identities = 17/58 (29%), Positives = 25/58 (43%) Frame = -2 Query: 615 FSHVILFLYCEIYNYFYNS*LICILYSNCHVKLK*IIYYICVPSFVIGKTLVILYYIR 442 F+ +LFL C Y Y L+CI Y C + ++ C S K+ L +R Sbjct: 275 FTMHLLFLLCIYYFYCALIILLCIYYF-CRAFIIFPTHFYCAFSLYPLKSTFYLNVVR 331 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 536 LYNMQINYEL*K*L*ISQYRNSITCENPALY 628 LY + NYE+ + + N I+ +NPA + Sbjct: 404 LYKLPPNYEIRHKFKLWNFNNQISDDNPARF 434 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 599 SITCENPALYGGYPCYTR 652 S +CEN LY G Y R Sbjct: 207 SQSCENATLYSGDEMYFR 224 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -3 Query: 455 YIIFVYLFVHNALYEVIQARYARI 384 Y F+Y H+ L +I +RY R+ Sbjct: 141 YCQFLYNCFHSTLLLMILSRYQRL 164 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,030 Number of Sequences: 336 Number of extensions: 3935 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18738900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -