BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0118 (709 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16C6.11 |rpl3201|rpl32-1|60S ribosomal protein L32|Schizosac... 26 6.1 SPAC3H5.10 |rpl3202|rpl32-2, rpl32|60S ribosomal protein L32|Sch... 26 6.1 SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic... 25 8.0 SPAC513.05 |ams1||alpha-mannosidase |Schizosaccharomyces pombe|c... 25 8.0 SPCC338.15 |||dolichyl-di-phosphooligosaccharide-protein glycotr... 25 8.0 >SPBC16C6.11 |rpl3201|rpl32-1|60S ribosomal protein L32|Schizosaccharomyces pombe|chr 2|||Manual Length = 127 Score = 25.8 bits (54), Expect = 6.1 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 110 SWKKPECQRKCVRRKFK 160 SW+KP CVRR+F+ Sbjct: 28 SWRKPRGIDSCVRRRFR 44 >SPAC3H5.10 |rpl3202|rpl32-2, rpl32|60S ribosomal protein L32|Schizosaccharomyces pombe|chr 1|||Manual Length = 127 Score = 25.8 bits (54), Expect = 6.1 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 110 SWKKPECQRKCVRRKFK 160 SW+KP CVRR+F+ Sbjct: 28 SWRKPRGIDSCVRRRFR 44 >SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic subunit Bgs1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1729 Score = 25.4 bits (53), Expect = 8.0 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -3 Query: 443 VYLFVHNALYEVIQARYAR 387 +Y F+H L+E++ +Y R Sbjct: 246 IYRFIHAQLFEILDGKYVR 264 >SPAC513.05 |ams1||alpha-mannosidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1077 Score = 25.4 bits (53), Expect = 8.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 296 DLKVYAMCDISNPHYNTV 349 DLKVY + D+S P +N V Sbjct: 64 DLKVYRVPDLSRPSFNEV 81 >SPCC338.15 |||dolichyl-di-phosphooligosaccharide-protein glycotransferase subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 437 Score = 25.4 bits (53), Expect = 8.0 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -2 Query: 684 ITQFYITRFQSLV*HGYPPYNAGFSHVILF-LYCEIY 577 + QF+ F + H YP Y + FS + F L+C I+ Sbjct: 384 LRQFFHNEFPRFLPHAYPYYASCFSVLGAFLLFCGIW 420 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,864,746 Number of Sequences: 5004 Number of extensions: 59322 Number of successful extensions: 117 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -