BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0118 (709 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 25 2.3 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 24 5.4 AY341149-1|AAR13713.1| 164|Anopheles gambiae aminopeptidase N p... 24 5.4 AY341147-1|AAR13711.1| 164|Anopheles gambiae aminopeptidase N p... 24 5.4 AY341146-1|AAR13710.1| 164|Anopheles gambiae aminopeptidase N p... 24 5.4 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 24 5.4 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 23 9.4 AY341150-1|AAR13714.1| 164|Anopheles gambiae aminopeptidase N p... 23 9.4 AY341148-1|AAR13712.1| 164|Anopheles gambiae aminopeptidase N p... 23 9.4 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 3/30 (10%) Frame = +3 Query: 519 ISHDNY---CTICKLIMNCRNNYKFHSTEI 599 IS++N+ CTIC + + R +Y+ H I Sbjct: 374 ISNENFGIKCTICHKLFSQRQDYQLHMRAI 403 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/34 (29%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -2 Query: 630 PYNAGFSHVILFLYCE--IYNYFYNS*LICILYS 535 P G+ + + Y E IY YN ++C++Y+ Sbjct: 189 PNITGYQQCVTYHYFEEEIYQIIYNVLVMCLMYT 222 >AY341149-1|AAR13713.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = -2 Query: 186 IPILAFN*NLNFRRTHFLWHSGFFHESRTW 97 + + N L F + HFL+ RTW Sbjct: 46 VTVTLSNGELTFMQEHFLYRGSVVTSDRTW 75 >AY341147-1|AAR13711.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = -2 Query: 186 IPILAFN*NLNFRRTHFLWHSGFFHESRTW 97 + + N L F + HFL+ RTW Sbjct: 46 VTVTLSNGELTFMQEHFLYRGSVVTSDRTW 75 >AY341146-1|AAR13710.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = -2 Query: 186 IPILAFN*NLNFRRTHFLWHSGFFHESRTW 97 + + N L F + HFL+ RTW Sbjct: 46 VTVTLSNGELTFMQEHFLYRGSVVTSDRTW 75 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/34 (29%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -2 Query: 630 PYNAGFSHVILFLYCE--IYNYFYNS*LICILYS 535 P G+ + + Y E IY YN ++C++Y+ Sbjct: 189 PNITGYQQCVTYHYFEEEIYQIIYNVLVMCLMYT 222 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 23.0 bits (47), Expect = 9.4 Identities = 10/42 (23%), Positives = 24/42 (57%) Frame = +3 Query: 513 ILISHDNYCTICKLIMNCRNNYKFHSTEIV*RVKTPRYMGDT 638 + IS + Y IC+ + + R +FH+ +++ V T ++ ++ Sbjct: 200 VAISLERYFAICRPLSSRRWQTQFHAYKMIGLVWTVSFLANS 241 >AY341150-1|AAR13714.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 23.0 bits (47), Expect = 9.4 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = -2 Query: 186 IPILAFN*NLNFRRTHFLWHSGFFHESRTW 97 + + N L F + HFL+ RTW Sbjct: 46 VTVTLSNGELTFMQEHFLYGGSVVTSDRTW 75 >AY341148-1|AAR13712.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 23.0 bits (47), Expect = 9.4 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = -2 Query: 186 IPILAFN*NLNFRRTHFLWHSGFFHESRTW 97 + + N L F + HFL+ RTW Sbjct: 46 VTVTLSNGELTFMQEHFLYGGSVVTSDRTW 75 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 715,582 Number of Sequences: 2352 Number of extensions: 15656 Number of successful extensions: 40 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -