BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0118 (709 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g04400.2 68414.m00431 cryptochrome 2 apoprotein (CRY2) / blue... 29 3.0 At1g04400.1 68414.m00430 cryptochrome 2 apoprotein (CRY2) / blue... 29 3.0 >At1g04400.2 68414.m00431 cryptochrome 2 apoprotein (CRY2) / blue light photoreceptor (PHH1) 97% identical to photolysase (PHH1) (SP:Q96524) and cryptochrome 2 apoprotein (CRY2) (SP:U43397). ESTs gb|W43661 and gb|Z25638 come from this gene; contains Pfam profiles PF03441: FAD binding domain of DNA photolyase and PF00875: deoxyribodipyrimidine photolyase; identical to cDNA Cvi cryptochrome 2 (CRY2) GI:18026275 Length = 612 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -3 Query: 431 VHNALYEVIQARYARILTTRIL*RGTNLPCYSGDYLYRTW 312 V N LY+ + + +++ RG ++ Y+GD LY W Sbjct: 99 VFNHLYDPVSLVRDHTVKEKLVERGISVQSYNGDLLYEPW 138 >At1g04400.1 68414.m00430 cryptochrome 2 apoprotein (CRY2) / blue light photoreceptor (PHH1) 97% identical to photolysase (PHH1) (SP:Q96524) and cryptochrome 2 apoprotein (CRY2) (SP:U43397). ESTs gb|W43661 and gb|Z25638 come from this gene; contains Pfam profiles PF03441: FAD binding domain of DNA photolyase and PF00875: deoxyribodipyrimidine photolyase; identical to cDNA Cvi cryptochrome 2 (CRY2) GI:18026275 Length = 612 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -3 Query: 431 VHNALYEVIQARYARILTTRIL*RGTNLPCYSGDYLYRTW 312 V N LY+ + + +++ RG ++ Y+GD LY W Sbjct: 99 VFNHLYDPVSLVRDHTVKEKLVERGISVQSYNGDLLYEPW 138 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,219,221 Number of Sequences: 28952 Number of extensions: 280961 Number of successful extensions: 392 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 389 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 392 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1526202912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -