BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0116 (690 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42245| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 >SB_42245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 41.5 bits (93), Expect = 6e-04 Identities = 18/47 (38%), Positives = 31/47 (65%), Gaps = 2/47 (4%) Frame = +1 Query: 556 KMLVIMCILSG--VNIFAWLNKPQPAWWSWCLENKLYACMMMFFLAN 690 K++ I I+ G V +F LN P ++W + NK+Y+C+++FFL+N Sbjct: 3 KLIAIGIIMLGEQVRLFENLNITPPEIYTWAVNNKMYSCILIFFLSN 49 >SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2735 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = -1 Query: 645 KAPTPPSRLWFVQPSKNIHTAEYTHDDQHFAKTNNS**IHVKTR 514 + P+P + F P NI A+ TH+ QH T S +HV+TR Sbjct: 2550 EGPSPVNTCGFRVPKMNIQGAKATHEVQHL--TLLSVELHVRTR 2591 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,382,998 Number of Sequences: 59808 Number of extensions: 449475 Number of successful extensions: 1191 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1190 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -