BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0116 (690 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 24 3.9 AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like pepti... 23 9.1 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -3 Query: 511 GIVSSNDRNLWVFLLYNSCIVFKYLFVATRITVIDIH 401 G+ + LW+ + N VF Y + T + +DIH Sbjct: 541 GLFTKLPNLLWLNISDNHLEVFDYALIPTGLQWLDIH 577 >AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like peptide 6 precursor protein. Length = 160 Score = 23.0 bits (47), Expect = 9.1 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +3 Query: 504 TIPTWF*HVSITNYWFWQNVGHH 572 T+P W V +NY + GH+ Sbjct: 100 TVPAWMNMVYPSNYMYRHGAGHN 122 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 754,653 Number of Sequences: 2352 Number of extensions: 17136 Number of successful extensions: 32 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -