BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0115 (771 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 22 4.7 AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory recept... 22 6.2 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 22 6.2 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 21 8.2 AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 21 8.2 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 21 8.2 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 22.2 bits (45), Expect = 4.7 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = -2 Query: 224 HHVPHISHRSRSFEAS 177 HH PH++H + A+ Sbjct: 40 HHSPHLNHAMHPYHAN 55 >AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory receptor candidate 52 protein. Length = 360 Score = 21.8 bits (44), Expect = 6.2 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 735 FVHRHSFVQYTLDFTMF 685 F+H + VQ TLD T++ Sbjct: 60 FIHIKAVVQITLDATLY 76 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.8 bits (44), Expect = 6.2 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 735 FVHRHSFVQYTLDFTMF 685 F+H + VQ TLD T++ Sbjct: 60 FIHIKAVVQITLDATLY 76 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.4 bits (43), Expect = 8.2 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +3 Query: 528 DEKEHGIFKRSGNDLILRMNIELVEALCGFQKVIR 632 D+KE +FK + L+L +I + + G+ + +R Sbjct: 123 DQKERNLFKNAYFQLVL--SISVYSSSVGYTQYVR 155 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 21.4 bits (43), Expect = 8.2 Identities = 11/58 (18%), Positives = 25/58 (43%) Frame = -1 Query: 492 FLITFSTKHNLLPINHTFIHMNFKNFTITYYFTSLTDFATVFRIYNLFLSTAFAAYCL 319 F++ F ++P+ H N + + + F V+ +YN+F + +C+ Sbjct: 35 FVVIFGQFFGIMPL-HGVSRKNVQEIRLEW-----KSFRFVYAVYNIFGAFVMGLFCI 86 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -2 Query: 227 YHHVPHISH 201 Y+H PH+SH Sbjct: 105 YNHSPHLSH 113 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,489 Number of Sequences: 336 Number of extensions: 4246 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20753800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -